Recombinant Pig P cadherin protein (His tag) (ab240870)
Key features and details
- Expression system: Yeast
- Purity: > 85% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
-
Product name
Recombinant Pig P cadherin protein (His tag)
See all P cadherin proteins and peptides -
Purity
> 85 % SDS-PAGE. -
Expression system
Yeast -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Pig -
Sequence
KIAKYELFGHAVSENGASVEEPMNISIIVTDQNDHKPKFTQDVFRGSVLE GVLPGTSVMQVTATDEDDAINTYNGVVAYSILSQEPKDPHDLMFTVHRST GAISVISSGLDRERVPEYTLTIQATDMDGDGSSTTATAIVEILDA -
Predicted molecular weight
18 kDa including tags -
Amino acids
1 to 145 -
Tags
His tag N-Terminus
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
Images
-
SDS-PAGE - Recombinant Pig P cadherin protein (His tag) (ab240870)
(Tris-Glycine gel) Discontinuous SDS-PAGE with 5% enrichment gel and 15% separation gel analysis of ab240870.
Lane 1: 45 & 22 kDa by EndoH digestion.
Lane 2: 58 & 35 kDa.
The reducing (R) protein migrates as 58 & 35 kDa in SDS-PAGE may be due to glycosylation and homodimer.
-
Mass Spectrometry - Recombinant Pig P cadherin protein (His tag) (ab240870)Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab240870 could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) P cadherin.
-
Mass Spectrometry - Recombinant Pig P cadherin protein (His tag) (ab240870)Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab240870 could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) P cadherin.
