Astana Biomed Group, an authorized Abcam distributor in Central Asia

Recombinant pig IL-8 protein (ab202818)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 95% SDS-PAGE
  • Endotoxin level: > 1.000 Eu/µg
  • Active: Yes
  • Suitable for: Functional Studies, HPLC, SDS-PAGE

Description

  • Product name

    Recombinant pig IL-8 protein
    See all IL-8 proteins and peptides

  • Biological activity

    ab202818 is fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using Human peripheral blood neutrophils is in a concentration range of 20-200 ng/mL.

  • Purity

    > 95 % SDS-PAGE.
    Purity is determined by SDS-PAGE and HPLC analyses.

  • Endotoxin level

    > 1.000 Eu/µg

  • Expression system

    Escherichia coli

  • Accession

    P26894

  • Protein length

    Full length protein

  • Animal free

    No

  • Nature

    Recombinant

    • Species

      Pig

    • Sequence

      ARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKE VCLDPKEKWVQKVVQIFLKRTEKQQQQQ

    • Predicted molecular weight

      9 kDa

    • Amino acids

      26 to 103

    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included. A single non-glycosylated polypeptide chain.

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at

    General Info

    • Alternative names

      • (Ala-IL-8)77
      • (Ser-IL-8)72
      • 9E3
      • Beta thromboglobulin like protein
      • C-X-C motif chemokine 8
      • CEF-4
      • chemokine, CXC motif, ligand 8
      • CXCL8
      • Emoctakin
      • GCP-1
      • GCP/IL-8 protein I
      • GCP/IL-8 protein II
      • GCP/IL-8 protein III
      • GCP/IL-8 protein IV
      • GCP/IL-8 protein V
      • GCP/IL-8 protein VI
      • GCP1
      • Granulocyte chemotactic protein 1
      • IL-8
      • IL-8(1-77)
      • IL-8(9-77)
      • IL8
      • IL8/NAP1 form I
      • IL8/NAP1 form II
      • IL8/NAP1 form III
      • IL8/NAP1 form IV
      • IL8/NAP1 form V
      • IL8/NAP1 form VI
      • IL8_HUMAN
      • Inteleukin 8
      • LECT
      • LUCT
      • Lymphocyte-derived neutrophil-activating factor
      • LYNAP
      • MDNCF
      • MDNCF-b
      • MDNCF-c
      • MONAP
      • Monocyte derived neutrophil activating peptide
      • Monocyte derived neutrophil chemotactic factor
      • Monocyte-derived neutrophil chemotactic factor
      • Monocyte-derived neutrophil-activating peptide
      • NAF
      • NAP 1
      • NAP-1
      • NAP1
      • Neutrophil activating peptide 1
      • Neutrophil activating protein 1
      • Neutrophil-activating factor
      • Neutrophil-activating protein 1
      • Protein 3 10C
      • Protein 3-10C
      • SCYB 8
      • SCYB8
      • Small inducible cytokine subfamily B member 8
      • T cell chemotactic factor
      • T-cell chemotactic factor
      • TSG 1
      • TSG1
      see all

    • Function

      IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.

    • Sequence similarities

      Belongs to the intercrine alpha (chemokine CxC) family.

    • Post-translational
      modifications

      Several N-terminal processed forms are produced by proteolytic cleavage after secretion from at least peripheral blood monocytes, leukcocytes and endothelial cells. In general, IL-8(1-77) is referred to as interleukin-8. IL-8(6-77) is the most promiment form.

    • Cellular localization

      Secreted.
    • Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

References (0)

Publishing research using ab202818? Please let us know so that we can cite the reference in this datasheet.

ab202818 has not yet been referenced specifically in any publications.

Images

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant pig IL-8 protein (ab202818)

Get resources and offers direct to your inbox Sign up