Recombinant Human IL-8 protein (ab204932)
Key features and details
- Expression system: Escherichia coli
- Suitable for: MS, SDS-PAGE, WB
-
Product name
Recombinant Human IL-8 protein
See all IL-8 proteins and peptides -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSD GRELCLDPKENWVQRVVEKFLKRAENS -
Predicted molecular weight
9 kDa -
Amino acids
23 to 99 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included.
-
Preparation and Storage
-
Alternative names
- (Ala-IL-8)77
- (Ser-IL-8)72
- 9E3
see all -
Function
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. -
Sequence similarities
Belongs to the intercrine alpha (chemokine CxC) family. -
Post-translational
modificationsSeveral N-terminal processed forms are produced by proteolytic cleavage after secretion from at least peripheral blood monocytes, leukcocytes and endothelial cells. In general, IL-8(1-77) is referred to as interleukin-8. IL-8(6-77) is the most promiment form. -
Cellular localization
Secreted. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human IL-8 protein (ab204932)
12% SDS-PAGE analysis of ab204932 stained with Coomassie Blue.
