Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (Tagged) (ab238290)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Suitable for: MS, SDS-PAGE
-
Product name
Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (Tagged) -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mycobacterium tuberculosis -
Sequence
MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLT DRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVR RVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS -
Predicted molecular weight
36 kDa including tags -
Amino acids
1 to 143 -
Additional sequence information
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. (Strain ATCC 25618 / H37Rv).
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
Images
-
SDS-PAGE - Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (Tagged) (ab238290)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab238290.
-
Mass Spectrometry - Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (Tagged) (ab238290)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238290 could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Hypoxic response protein 1.
-
Mass Spectrometry - Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (Tagged) (ab238290)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238290 could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Hypoxic response protein 1.