Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Innate Immunity Chemokines Alpha Chemokines (CXC)

Recombinant Mouse MCP1 protein (Fc Chimera) (ab215027)

Key features and details

  • Expression system: CHO cells
  • Purity: >= 98% SDS-PAGE
  • Endotoxin level:
  • Suitable for: SDS-PAGE

You may also be interested in

Product image
Human CXCL1 (GRO alpha) knockout HeLa cell lysate (ab257079)
Product image
Biotin Anti-CXCL5 antibody (ab271281)
Product image
Anti-CXCL9 antibody [EPR17005-14] (ab222611)
Product image
Mouse MIP2 Matched Antibody Pair Kit (ab211762)

Description

  • Product name

    Recombinant Mouse MCP1 protein (Fc Chimera)
    See all MCP1 proteins and peptides
  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

  • Expression system

    CHO cells
  • Accession

    P10148
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKRE VCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKS EANASTTFSTTTSSTSVGVTSVTVN
    • Amino acids

      24 to 148
    • Additional sequence information

      Extracellular domain fused to the N-terminus of the Fc region of mouse IgG2a. (NP_035463.1).
  • Associated products

      Specifications

      Our Abpromise guarantee covers the use of ab215027 in the following tested applications.

      The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

      • Applications

        SDS-PAGE

      • Form

        Lyophilized
      • Concentration information loading...

      Preparation and Storage

      • Stability and Storage

        Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

        Constituent: PBS

        Lyophilized from 0.2 µm filtered solution.

      • Reconstitution
        Reconstitute vial with 100 µL sterile water. Working aliquots are stable for up to 3 months when stored at -20°C.

      General Info

      • Alternative names

        • C-C motif chemokine 2
        • CCL2
        • CCL2_HUMAN
        • Chemokine (C C motif) ligand 2
        • GDCF 2
        • GDCF-2
        • GDCF2
        • HC11
        • HSMCR30
        • JE
        • MCAF
        • MCP 1
        • MCP-1
        • MCP1
        • MGC9434
        • Monocyte chemoattractant protein 1
        • Monocyte chemotactic and activating factor
        • Monocyte chemotactic protein 1
        • Monocyte secretory protein JE
        • SCYA2
        • Small inducible cytokine A2
        • Small inducible cytokine A2 (monocyte chemotactic protein 1, homologous to mouse Sig je)
        • Small inducible cytokine subfamily A (Cys Cys), member 2
        • Small-inducible cytokine A2
        • SMC CF
        • SMC-CF
        • SMCCF
        see all
      • Function

        Chemotactic factor that attracts monocytes and basophils but not neutrophils or eosinophils. Augments monocyte anti-tumor activity. Has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis or atherosclerosis. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis.
      • Sequence similarities

        Belongs to the intercrine beta (chemokine CC) family.
      • Post-translational
        modifications

        Processing at the N-terminus can regulate receptor and target cell selectivity. Deletion of the N-terminal residue converts it from an activator of basophil to an eosinophil chemoattractant.
      • Cellular localization

        Secreted.
      • Target information above from: UniProt accession P13500 The UniProt Consortium
        The Universal Protein Resource (UniProt) in 2010
        Nucleic Acids Res. 38:D142-D148 (2010) .

        Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab215027? Please let us know so that we can cite the reference in this datasheet.

    ab215027 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Alternative names

      • C-C motif chemokine 2
      • CCL2
      • CCL2_HUMAN
      • Chemokine (C C motif) ligand 2
      • GDCF 2
      • GDCF-2
      • GDCF2
      • HC11
      • HSMCR30
      • JE
      • MCAF
      • MCP 1
      • MCP-1
      • MCP1
      • MGC9434
      • Monocyte chemoattractant protein 1
      • Monocyte chemotactic and activating factor
      • Monocyte chemotactic protein 1
      • Monocyte secretory protein JE
      • SCYA2
      • Small inducible cytokine A2
      • Small inducible cytokine A2 (monocyte chemotactic protein 1, homologous to mouse Sig je)
      • Small inducible cytokine subfamily A (Cys Cys), member 2
      • Small-inducible cytokine A2
      • SMC CF
      • SMC-CF
      • SMCCF
      see all
    • Function

      Chemotactic factor that attracts monocytes and basophils but not neutrophils or eosinophils. Augments monocyte anti-tumor activity. Has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis or atherosclerosis. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis.
    • Sequence similarities

      Belongs to the intercrine beta (chemokine CC) family.
    • Post-translational
      modifications

      Processing at the N-terminus can regulate receptor and target cell selectivity. Deletion of the N-terminal residue converts it from an activator of basophil to an eosinophil chemoattractant.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession P13500 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Alternative products to Recombinant Mouse MCP1 protein (Fc Chimera) (ab215027)

    •  
    • Recombinant mouse MCP1 protein (ab9901)

      Applications: FuncS, SDS-PAGE

    •  
    • Product image

      Recombinant human MCP1 protein (ab73866)

      Applications: FuncS, SDS-PAGE, WB

    •  
    • Recombinant Mouse MCP1 protein (His tag) (ab215583)

      Applications: SDS-PAGE

    •  
    • Recombinant pig MCP1 protein (ab88005)

      Applications: FuncS, SDS-PAGE

    •  
    • Recombinant human MCP1 protein (Animal Free) (ab217443)

      Applications: FuncS, HPLC, SDS-PAGE

    •  
    • Recombinant human MCP1 protein (ab9670)

      Applications: FuncS, SDS-PAGE

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.