Recombinant Mouse MCP1 protein (Fc Chimera) (ab215027)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Mouse MCP1 protein (Fc Chimera)
See all MCP1 proteins and peptides -
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKRE VCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKS EANASTTFSTTTSSTSVGVTSVTVN -
Amino acids
24 to 148 -
Additional sequence information
Extracellular domain fused to the N-terminus of the Fc region of mouse IgG2a. (NP_035463.1).
Associated products
Specifications
Our Abpromise guarantee covers the use of ab215027 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
Constituent: PBS
Lyophilized from 0.2 µm filtered solution. -
ReconstitutionReconstitute vial with 100 µL sterile water. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- C-C motif chemokine 2
- CCL2
- CCL2_HUMAN
see all -
Function
Chemotactic factor that attracts monocytes and basophils but not neutrophils or eosinophils. Augments monocyte anti-tumor activity. Has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis or atherosclerosis. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsProcessing at the N-terminus can regulate receptor and target cell selectivity. Deletion of the N-terminal residue converts it from an activator of basophil to an eosinophil chemoattractant. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab215027 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- C-C motif chemokine 2
- CCL2
- CCL2_HUMAN
see all -
Function
Chemotactic factor that attracts monocytes and basophils but not neutrophils or eosinophils. Augments monocyte anti-tumor activity. Has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis or atherosclerosis. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsProcessing at the N-terminus can regulate receptor and target cell selectivity. Deletion of the N-terminal residue converts it from an activator of basophil to an eosinophil chemoattractant. -
Cellular localization
Secreted. - Information by UniProt
