Recombinant Mouse IL-19 protein (Animal Free) (ab207978)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Mouse IL-19 protein (Animal Free)
See all IL-19 proteins and peptides -
Purity
> 95 % SDS-PAGE.
The purity of ab207978 was determined by reducing and non-reducing SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
YesNature
Recombinant-
Species
Mouse -
Sequence
MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDV CCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVH RQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLET PAA -
Predicted molecular weight
18 kDa -
Amino acids
25 to 176 -
Additional sequence information
Mature form without initial signal peptode, but with an additional Met.
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab207978 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: 0.87% Sodium chloride, 0.08% Sodium phosphate
Lyophilized from a sterile filtered aqueous solution. -
ReconstitutionReconstitute in sterile water at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 ºC and avoid repeat freeze thaws.
General Info
-
Alternative names
- IL 10C
- IL 19
- IL-19
see all -
Function
May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis. -
Sequence similarities
Belongs to the IL-10 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab207978 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: 0.87% Sodium chloride, 0.08% Sodium phosphate
Lyophilized from a sterile filtered aqueous solution. -
ReconstitutionReconstitute in sterile water at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 ºC and avoid repeat freeze thaws.