Recombinant Mouse ICOS Ligand/ICOSL protein (Fc Chimera) (ab215004)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Mouse ICOS Ligand/ICOSL protein (Fc Chimera)
See all ICOS Ligand/ICOSL proteins and peptides -
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
TEVGAMVGSNVVLSCIDPHRRHFNLSGLYVYWQIENPEVSVTYYLPYKSP GINVDSSYKNRGHLSLDSMKQGNFSLYLKNVTPQDTQEFTCRVFMNTATE LVKILEEVVRLRVAANFSTPVISTSDSSNPGQE RTYTCMSKNGYPEPN LYWINTTDNSLIDTALQNNTVYLNKLGLYDVISTLRLPWTSRGDVLCCVE NVALHQNITSISQAESFTGNNTKNPQETHNNEL -
Amino acids
48 to 279 -
Additional sequence information
Extracellular domain fused to the N terminus of the Fc region of mouse IgG2a.
Specifications
Our Abpromise guarantee covers the use of ab215004 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product was previously labelled as ICOS Ligand
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 100% PBS
Lyophilized from 0.2 µm filtered solution. -
ReconstitutionReconstitute at 100 µg/mL in sterile PBS. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- B7 H2
- B7 homolog 2
- B7 homologue 2
see all -
Function
Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function. -
Tissue specificity
Isoform 1 is widely expressed (brain, heart, kidney, liver, lung, pancreas, placenta, skeletal muscle, bone marrow, colon, ovary, prostate, testis, lymph nodes, leukocytes, spleen, thymus and tonsil), while isoform 2 is detected only in lymph nodes, leukocytes and spleen. Expressed on activated monocytes and dendritic cells. -
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab215004 has not yet been referenced specifically in any publications.
Preparation and Storage
- B7 H2
- B7 homolog 2
- B7 homologue 2