Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Growth Factors/Hormones TGF

Recombinant mouse BMP4 protein (Active) (ab245810)

Price and availability

167 520 ₸

Availability

Order now and get it on Thursday February 25, 2021

Key features and details

  • Expression system: Escherichia coli
  • Purity: >= 98% SDS-PAGE
  • Active: Yes
  • Suitable for: HPLC, SDS-PAGE, Functional Studies

You may also be interested in

Product image
Anti-BAMBI/NMA antibody (ab203070)
Product image
Anti-BMP4 antibody [EPR6211] - BSA and Azide free (ab271886)
Product image
Recombinant human TGF beta 2 protein (Active) (ab277760)
Product image
Anti-BMP4 antibody (ab155033)

Description

  • Product name

    Recombinant mouse BMP4 protein (Active)
    See all BMP4 proteins and peptides
  • Biological activity

    Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml.

  • Purity

    >= 98 % SDS-PAGE.
    = 98% by HPLC.
  • Expression system

    Escherichia coli
  • Accession

    P21275
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNST NHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVV EGCGCR
    • Predicted molecular weight

      12 kDa
    • Amino acids

      303 to 408
    • Additional sequence information

      ab245810 is a fully active homodimeric protein consisting of two 106 amino acid subunits which correspond to amino acids 303-408 of the full length BMP-4 precursor.

Preparation and Storage

  • Alternative names

    • zgc:100779
    • BMP 2B
    • BMP 4
    • BMP-2B
    • BMP-4
    • BMP2B
    • BMP2B1
    • BMP4
    • BMP4_HUMAN
    • Bone morphogenetic protein 2B
    • Bone morphogenetic protein 4
    • DVR4
    • MCOPS6
    • MGC100779
    • OFC11
    • zbmp-4
    • ZYME
    see all
  • Function

    Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction.
  • Tissue specificity

    Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines.
  • Involvement in disease

    Defects in BMP4 are the cause of microphthalmia syndromic type 6 (MCOPS6) [MIM:607932]; also known as microphthalmia and pituitary anomalies or microphthalmia with brain and digit developmental anomalies. Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues (anophthalmia). In many cases, microphthalmia/anophthalmia occurs in association with syndromes that include non-ocular abnormalities. MCOPS6 is characterized by microphthalmia/anophthalmia associated with facial, genital, skeletal, neurologic and endocrine anomalies.
    Defects in BMP4 are the cause of non-syndromic orofacial cleft type 11 (OFC11) [MIM:600625]. Non-syndromic orofacial cleft is a common birth defect consisting of cleft lips with or without cleft palate. Cleft lips are associated with cleft palate in two-third of cases. A cleft lip can occur on one or both sides and range in severity from a simple notch in the upper lip to a complete opening in the lip extending into the floor of the nostril and involving the upper gum. OFC11 is an unusual anomaly consisting of a paramedian scar of the upper lip with an appearance suggesting that a typical cleft lip was corrected in utero.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Target information above from: UniProt accession P12644 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant mouse BMP4 protein (Active) (ab245810)

  •  
  • Recombinant human BMP4 protein (ab51998)

    Applications: SDS-PAGE

  •  
  • Product image

    Recombinant Human BMP4 protein (ab92855)

    Applications: ELISA, SDS-PAGE, WB

  •  
  • Recombinant human BMP4 protein (Active) (ab226417)

    Applications: FuncS, SDS-PAGE

  •  
  • Product image

    Recombinant Human BMP4 protein (ab87063)

    Applications: SDS-PAGE

  •  
  • Product image

    Recombinant human BMP4 protein (Active) (ab238298)

    Applications: FuncS, SDS-PAGE

Clear all

Recently viewed products

  •  
  • Product image

    Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10] (ab140307)

  •  
  • Product image

    Anti-DDB1 with anti-GAPDH internal loading control antibody (ab75393)

  •  
  • Product image

    PE/Cy7<sup>®</sup> Conjugation Kit - Lightning-Link® (ab102903)

  •  
  • Product image

    Human PPIF (Cyclophilin F) knockout HEK-293T cell line (ab266077)

  •  
  • Product image

    Human Pro-Collagen I C-Terminal Propeptide Antibody Pair - BSA and Azide free (PICP) (ab253334)

  •  
  • Product image

    Recombinant human Activin Receptor Type IA (deleted P197, mutated F198L) protein (ab204142)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.