Recombinant Influenza A Polymerase acidic protein (His tag) (ab239539)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: MS, SDS-PAGE
-
Product name
Recombinant Influenza A Polymerase acidic protein (His tag) -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Influenza A -
Sequence
RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKT RLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNF SSLENFRAYVDGFEPNGYIEGKLS -
Predicted molecular weight
19 kDa including tags -
Amino acids
124 to 247 -
Tags
His tag N-Terminus -
Additional sequence information
Strain A/x-31 H3N2.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
Images
-
SDS-PAGE - Recombinant Influenza A Polymerase acidic protein (His tag) (ab239539)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab239539.
-
Mass Spectrometry - Recombinant Influenza A Polymerase acidic protein (His tag) (ab239539)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab239539 could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/x-31 H3N2) Polymerase acidic protein.
-
Mass Spectrometry - Recombinant Influenza A Polymerase acidic protein (His tag) (ab239539)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab239539 could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/x-31 H3N2) Polymerase acidic protein.