Recombinant Human Von Willebrand Factor protein (Tagged) (ab152801)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: SDS-PAGE, WB, ELISA
-
Product name
Recombinant Human Von Willebrand Factor protein (Tagged)
See all Von Willebrand Factor proteins and peptides -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGAQDEEEGIQDLDGLLVFDKIVEVTLLNLPWYNEETEGQRGEMTAPKSP RAKIRGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAG GCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPY ASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCG NFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNIS SGEMQKVGVDWPGCTWMVCDFWI -
Predicted molecular weight
56 kDa including tags -
Amino acids
1 to 273 -
Tags
GST tag N-Terminus
-
Preparation and Storage
-
Alternative names
- Coagulation factor VIII
- Coagulation factor VIII VWF
- F8VWF
see all -
Function
Important in the maintenance of hemostasis, it promotes adhesion of platelets to the sites of vascular injury by forming a molecular bridge between sub-endothelial collagen matrix and platelet-surface receptor complex GPIb-IX-V. Also acts as a chaperone for coagulation factor VIII, delivering it to the site of injury, stabilizing its heterodimeric structure and protecting it from premature clearance from plasma. -
Tissue specificity
Plasma. -
Involvement in disease
Defects in VWF are the cause of von Willebrand disease (VWD) [MIM:277480]. VWD defines a group of hemorrhagic disorders in which the von Willebrand factor is either quantitatively or qualitatively abnormal resulting in altered platelet function. Symptoms vary depending on severity and disease type but may include prolonged bleeding time, deficiency of factor VIII and impaired platelet adhesion. Type I von Willebrand disease is the most common form and is characterized by partial quantitative plasmatic deficiency of an otherwise structurally and functionally normal Willebrand factor; type II is associated with a qualitative deficiency and functional anomalies of the Willebrand factor; type III is the most severe form and is characterized by total or near-total absence of Willebrand factor in the plasma and cellular compartments, also leading to a profound deficiency of plasmatic factor VIII. -
Sequence similarities
Contains 1 CTCK (C-terminal cystine knot-like) domain.
Contains 4 TIL (trypsin inhibitory-like) domains.
Contains 3 VWFA domains.
Contains 3 VWFC domains.
Contains 4 VWFD domains. -
Domain
The von Willebrand antigen 2 is required for multimerization of vWF and for its targeting to storage granules. -
Post-translational
modificationsAll cysteine residues are involved in intrachain or interchain disulfide bonds.
N- and O-glycosylated. -
Cellular localization
Secreted. Secreted > extracellular space > extracellular matrix. Localized to storage granules. - Information by UniProt