Recombinant human VEGFA protein (Animal Free) (ab217394)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: HPLC, Functional Studies, SDS-PAGE
-
Product name
Recombinant human VEGFA protein (Animal Free)
See all VEGFA proteins and peptides -
Biological activity
Determined by the dose-dependent stimulation of the proliferation of Human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0–8.0 ng/mL.
-
Purity
> 98 % SDS-PAGE.
> 98% by HPLC analysis. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQ LELNERTCRCDKPRR -
Predicted molecular weight
38 kDa -
Amino acids
27 to 191 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included. Disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.