Recombinant human VEGF 165A protein (ab56620)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant human VEGF 165A protein
See all VEGF 165A proteins and peptides -
Biological activity
Biological Activity: The biological activity is determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-5.0 ng/ml.
-
Purity
> 95 % SDS-PAGE.
> 98% by SDS-PAGE and HPLC analyses. Endotoxin level: -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQ LELNERTCRCDKPRR -
Predicted molecular weight
38 kDa -
Amino acids
27 to 191
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in 50 mM acetic acid to a concentration of not less than 50 µg/ml. This solution can then be diluted into other aqueous buffers. For long term storage it is recommended to add at least 0.1% human or BSA.
Images
-
SDS-PAGE - Recombinant human VEGF 165A protein (ab56620)SDS-PAGE analysis of recombinant human VEGF165. Sample was loaded in 15% SDS-polyacrylamide gel under non-reducing condition and stained with Coomassie blue.
-
Functional Studies - Recombinant human VEGF 165A protein (ab56620)VEGF165-induced proliferation of HUVE cells. HUVECs were stimulated with increasing amounts of human VEGF165. -
SDS-PAGE - Recombinant human VEGF 165A protein (ab56620)SDS PAGE analysis of ab56620. Stained with Coomassie Blue.
-
Functional Studies - Recombinant human VEGF 165A protein (ab56620)Confluent PAE/KDR cells were stimulated with 50ng/ml human VEGF165 for 10 min at 37°C. Cells were lysed and an IP was performed using a mouse anti-human KDR antibody. WB was performed with a mouse anti-human KDR antibody and an anti-Phosphotyrosine antibody.
