Recombinant human TWEAK protein (Animal Free) (ab217458)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC
-
Product name
Recombinant human TWEAK protein (Animal Free)
See all TWEAK proteins and peptides -
Biological activity
Assay #1: The ED50 as determined by the dose-dependent stimulation of IL-8 production by human PBMC is less than 10 ng/ml.
Assay #2: TWEAK weakly induces the death of HT29 cells when cultured in the presence of IFN-γ. The ED50 for this effect is between 30-45 ng/ml. -
Purity
> 98 % SDS-PAGE.
assessed also by HPLC -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
MKGRKTRARR AIAAHYEVHP RPGQDGAQAG VDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAV YLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLR IRTLPWAHLKAAPFLTYFGLFQVH -
Predicted molecular weight
17 kDa -
Amino acids
97 to 249 -
Additional sequence information
comprising the TNF-homologous region of TWEAK, generated by proteolytic processing of the full length membrane-anchored TWEAK protein
-
Preparation and Storage
-
Alternative names
- APO 3 ligand
- APO 3L
- APO3 ligand
see all -
Function
Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokines. -
Tissue specificity
Highly expressed in adult heart, pancreas, skeletal muscle, brain, colon, small intestine, lung, ovary, prostate, spleen, lymph node, appendix and peripheral blood lymphocytes. Low expression in kidney, testis, liver, placenta, thymus and bone marrow. Also detected in fetal kidney, liver, lung and brain. -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Post-translational
modificationsThe soluble form derives from the membrane form by proteolytic processing. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt