Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Innate Immunity Macrophage / Inflamm.

Recombinant Human TIM 3 protein (Tagged) (ab268008)

Key features and details

  • Expression system: Mammalian
  • Purity: > 85% SDS-PAGE
  • Tags: Fc tag C-Terminus
  • Suitable for: SDS-PAGE

You may also be interested in

Product image
Anti-MKK7 (phospho S271 + T275) antibody [MKK7S271T275-R4F9] (ab278704)
Product image
Recombinant Human Myeloperoxidase protein (ab158915)
Product image
Anti-IFNA14 antibody (ab168449)
Product image
Anti-TLR3 antibody - BSA and Azide free (Capture) (ab281532)

Description

  • Product name

    Recombinant Human TIM 3 protein (Tagged)
    See all TIM 3 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Mammalian
  • Accession

    Q8TDQ0
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLR TDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMN DEKFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLP DINLTQISTLANELRDSRLANDLRDSGATIR
    • Predicted molecular weight

      33 kDa
    • Amino acids

      20 to 200
    • Tags

      Fc tag C-Terminus

Preparation and Storage

  • Alternative names

    • CD366
    • FLJ14428
    • HAVcr-2
    • Havcr2
    • HAVR2_HUMAN
    • Hepatitis A virus cellular receptor 2
    • Kidney injury molecule 3
    • KIM 3
    • KIM3
    • T cell immunoglobulin and mucin domain containing 3
    • T cell immunoglobulin mucin 3
    • T-cell immunoglobulin and mucin domain-containing protein 3
    • T-cell immunoglobulin mucin family member 3
    • T-cell immunoglobulin mucin receptor 3
    • T-cell membrane protein 3
    • Tim 3
    • TIM-3
    • TIM3
    • TIMD-3
    • TIMD3
    see all
  • Function

    Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand (PubMed:24825777). Regulates macrophage activation (PubMed:11823861). Inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance (PubMed:14556005). In CD8+ cells attenuates TCR-induced signaling, specifically by blocking NF-kappaB and NFAT promoter activities resulting in the loss of IL-2 secretion. The function may implicate its association with LCK proposed to impair phosphorylation of TCR subunits, and/or LGALS9-dependent recruitment of PTPRC to the immunological synapse (PubMed:24337741, PubMed:26492563). In contrast, shown to activate TCR-induced signaling in T-cells probably implicating ZAP70, LCP2, LCK and FYN (By similarity). Expressed on Treg cells can inhibit Th17 cell responses (PubMed:24838857). Receptor for LGALS9 (PubMed:16286920, PubMed:24337741). Binding to LGALS9 is believed to result in suppression of T-cell responses; the resulting apoptosis of antigen-specific cells may implicate HAVCR2 phosphorylation and disruption of its association with BAG6. Binding to LGALS9 is proposed to be involved in innate immune response to intracellular pathogens. Expressed on Th1 cells interacts with LGALS9 expressed on Mycobacterium tuberculosis-infected macrophages to stimulate antibactericidal activity including IL-1 beta secretion and to restrict intracellular bacterial growth (By similarity). However, the function as receptor for LGALS9 has been challenged (PubMed:23555261). Also reported to enhance CD8+ T-cell responses to an acute infection such as by Listeria monocytogenes (By similarity). Receptor for phosphatidylserine (PtSer); PtSer-binding is calcium-dependent. May recognize PtSer on apoptotic cells leading to their phagocytosis. Mediates the engulfment of apoptotic cells by dendritic cells. Expressed on T-cells, promotes conjugation but not engulfment of apoptotic cells. Expressed on dendritic cells (DCs) positively regulates innate immune response and in synergy with Toll-like receptors promotes secretion of TNF-alpha. In tumor-imfiltrating DCs suppresses nucleic acid-mediated innate immune repsonse by interaction with HMGB1 and interfering with nucleic acid-sensing and trafficking of nucleid acids to endosomes (By similarity). Expressed on natural killer (NK) cells acts as a coreceptor to enhance IFN-gamma production in response to LGALS9 (PubMed:22323453). In contrast, shown to suppress NK cell-mediated cytotoxicity (PubMed:22383801). Negatively regulates NK cell function in LPS-induced endotoxic shock.
  • Tissue specificity

    Expressed in T-helper type 1 (Th1) lymphocytes. Expressed on regulatory T (Treg) cells after TCR stimulation. Expressed in dendritic cells and natural killer (NK) cells. Expressed in epithelial tissues. Expression is increased on CD4+ and CD8+ T-cells in chronic hepatitis C virus (HCV) infection. In progressive HIV-1 infection, expression is up-regulated on HIV-1-specific CD8 T-cells.
  • Involvement in disease

    May be involved in T-cell exhaustion associated with chronic viral infections such as with human immunodeficiency virus (HIV) and hepatitic C virus (HCV).
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. TIM family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    O-glycosylated with core 1 or possibly core 8 glycans.
    Phosphorylated on tyrosine residues; modestly increased after TCR/CD28 stimulation. Can be phosphorylated in the cytoplasmatic domain by FYN (By similarity). Phosphorylation at Tyr-265 is increased by stimulation with ligand LGALS9.
  • Cellular localization

    Membrane. Cell junction. Localizes to the immunological synapse between CD8+ T-cells and target cells.
  • Target information above from: UniProt accession Q8TDQ0 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant Human TIM 3 protein (Tagged) (ab268008)

  •  
  • Product image

    Recombinant human TIM 3 protein (Active) (ab182714)

    Applications: ELISA, FuncS, SDS-PAGE

  •  
  • Product image

    Recombinant Human TIM 3 protein (Fc Chimera) (ab224631)

    Applications: ELISA, SDS-PAGE

  •  
  • Product image

    Recombinant cynomolgus monkey TIM 3 protein (Fc Chimera Active) (ab223109)

    Applications: FuncS, SDS-PAGE

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Junctional Adhesion Molecule 1/JAM-A antibody [EPR23246-275] - BSA and Azide free (ab272172)

  •  
  • Product image

    Anti-HTF9C/TRMT2A antibody - C-terminal (ab229733)

  •  
  • Product image

    Anti-14-3-3 alpha + beta antibody - C-terminal (ab216618)

  •  
  • Product image

    Alexa Fluor® 790 Anti-beta Actin antibody [mAbcam 8226] - Loading Control (ab184576)

  •  
  • Product image

    Mouse monoclonal [KT100] Anti-Rat IgG+IgM light chain (HRP) (ab106762)

  •  
  • Product image

    Anti-beta 2 Microglobulin antibody - BSA and Azide free (Capture) (ab244659)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.