Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cardiovascular Atherosclerosis Thrombosis Platelets

Recombinant human Syk protein (ab196062)

Recombinant human Syk protein (ab196062)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Baculovirus infected Sf9 cells
  • Purity: >= 60% SDS-PAGE
  • Active: Yes
  • Tags: GST tag N-Terminus
  • Suitable for: SDS-PAGE, Functional Studies

You may also be interested in

Product image
Biotin Anti-CD62P antibody [AK4] (ab239233)
Product image
Native Human Fibrinogen protein (ab84410)
Product image
Anti-CD31 antibody - BSA and Azide free (Capture) (ab242462)
Product image
Anti-CD31 antibody [WM59] - BSA and Azide free (ab252265)

Description

  • Product name

    Recombinant human Syk protein
    See all Syk proteins and peptides
  • Biological activity

    Specific activity: 139 pmol/min/μg.

    SYK was incubated with a substrate for 1 hour at RT in 1X kinase buffer supplemented with ATP. Developer solution was added to reaction and reaction was stopped after 1 hour of incubation at RT.

  • Purity

    >= 60 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

    P43405
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEA NDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNK YLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYA KISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSF GVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLC WTYDVENRPGFAAVELRLRNYYYDVVN
    • Predicted molecular weight

      58 kDa including tags
    • Amino acids

      359 to 635
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_003177.

Preparation and Storage

  • Alternative names

    • EC 2.7.10.2
    • kinase Syk
    • KSYK
    • KSYK_HUMAN
    • p72-Syk
    • p72syk
    • Spleen tyrosine kinase
    • Syk
    • Tyrosine protein kinase SYK
    • Tyrosine-protein kinase SYK
    see all
  • Function

    Non-receptor tyrosine kinase which mediates signal transduction downstream of a variety of transmembrane receptors including classical immunoreceptors like the B-cell receptor (BCR). Regulates several biological processes including innate and adaptive immunity, cell adhesion, osteoclast maturation, platelet activation and vascular development. Assembles into signaling complexes with activated receptors at the plasma membrane via interaction between its SH2 domains and the receptor tyrosine-phosphorylated ITAM domains. The association with the receptor can also be indirect and mediated by adapter proteins containing ITAM or partial hemITAM domains. The phosphorylation of the ITAM domains is generally mediated by SRC subfamily kinases upon engagement of the receptor. More rarely signal transduction via SYK could be ITAM-independent. Direct downstream effectors phosphorylated by SYK include VAV1, PLCG1, PI-3-kinase, LCP2 and BLNK. Initially identified as essential in B-cell receptor (BCR) signaling, it is necessary for the maturation of B-cells most probably at the pro-B to pre-B transition. Activated upon BCR engagement, it phosphorylates and activates BLNK an adapter linking the activated BCR to downstream signaling adapters and effectors. It also phosphorylates and activates PLCG1 and the PKC signaling pathway. It also phosphorylates BTK and regulates its activity in B-cell antigen receptor (BCR)-coupled signaling. In addition to its function downstream of BCR plays also a role in T-cell receptor signaling. Plays also a crucial role in the innate immune response to fungal, bacterial and viral pathogens. It is for instance activated by the membrane lectin CLEC7A. Upon stimulation by fungal proteins, CLEC7A together with SYK activates immune cells inducing the production of ROS. Also activates the inflammasome and NF-kappa-B-mediated transcription of chemokines and cytokines in presence of pathogens. Regulates neutrophil degranulation and phagocytosis through activation of the MAPK signaling cascade. Also mediates the activation of dendritic cells by cell necrosis stimuli. Also involved in mast cells activation. Also functions downstream of receptors mediating cell adhesion. Relays for instance, integrin-mediated neutrophils and macrophages activation and P-selectin receptor/SELPG-mediated recruitment of leukocytes to inflammatory loci. Plays also a role in non-immune processes. It is for instance involved in vascular development where it may regulate blood and lymphatic vascular separation. It is also required for osteoclast development and function. Functions in the activation of platelets by collagen, mediating PLCG2 phosphorylation and activation. May be coupled to the collagen receptor by the ITAM domain-containing FCER1G. Also activated by the membrane lectin CLEC1B that is required for activation of platelets by PDPN/podoplanin. Involved in platelet adhesion being activated by ITGB3 engaged by fibrinogen.
  • Tissue specificity

    Widely expressed in hematopoietic cells (at protein level). Within the B-cells compartment it is for instance expressed for pro-B-cells to plasma cells.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. SYK/ZAP-70 subfamily.
    Contains 1 protein kinase domain.
    Contains 2 SH2 domains.
  • Domain

    The SH2 domains mediate the interaction of SYK with the phosphorylated ITAM domains of transmembrane proteins. Some proteins like CLEC1B have a partial ITAM domain (also called hemITAM) containing a single YxxL motif. The interaction with SYK requires CLEC1B homodimerization.
  • Post-translational
    modifications

    Ubiquitinated by CBLB after BCR activation; which promotes proteasomal degradation.
    Autophosphorylated. Phosphorylated on tyrosine residues by LYN following receptors engagement. Phosphorylation on Tyr-323 creates a binding site for CBL, an adapter protein that serves as a negative regulator of BCR-stimulated calcium ion signaling. Phosphorylation at Tyr-348 creates a binding site for VAV1. Phosphorylation on Tyr-348 and Tyr-352 enhances the phosphorylation and activation of phospholipase C-gamma and the early phase of calcium ion mobilization via a phosphoinositide 3-kinase-independent pathway (By similarity). Phosphorylation on Ser-297 is very common, it peaks 5 minutes after BCR stimulation, and creates a binding site for YWHAG. Phosphorylation at Tyr-630 creates a binding site for BLNK. Dephosphorylated by PTPN6.
  • Cellular localization

    Cell membrane. Cytoplasm, cytosol.
  • Target information above from: UniProt accession P43405 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant human Syk protein (ab196062)
    SDS-PAGE - Recombinant human Syk protein (ab196062)

    10% SDS-PAGE analysis of 8 μg ab196062 with Coomassie staining.

  • Functional Studies - Recombinant human Syk protein (ab196062)
    Functional Studies - Recombinant human Syk protein (ab196062)

    Kinase assay using ab196062

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant human Syk protein (ab196062)

  •  
  • Product image

    Syk overexpression 293T lysate (whole cell) (ab94330)

    Applications: WB

  •  
  • Product image

    Recombinant human Syk protein (ab60886)

    Applications: FuncS, SDS-PAGE, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Serum Response Factor SRF antibody (ab53147)

  •  
  • Product image

    Anti-Sin3b antibody (ab101841)

  •  
  • Product image

    Anti-LANCL2 antibody (ab88860)

  •  
  • Product image

    Anti-CD82 antibody (ab262695)

  •  
  • Product image

    Anti-DEK antibody (ab245429)

  •  
  • Product image

    Anti-Vgl4 antibody (ab222829)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.