Recombinant human SOD2/MnSOD protein (ab93946)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, MS
-
Product name
Recombinant human SOD2/MnSOD protein
See all SOD2/MnSOD proteins and peptides -
Biological activity
Specific activity is > 1,200 units/mg, in which one unit will inhibit the rate of reduction of cytochrome c by 50% in a coupled system, using xanthine and Xanthine oxidase at pH 7.8 at 25°C in a 1.5 ml reaction volume.Activity Assay
- Prepare a 1.5 ml reaction mix into a suitable container and pre-chill on ice before use: The final concentrations are 50mM potassium phosphate, 0.1mM ethylendiaminetetraacetic acid, 0.01mM cytochrome C, 0.05mM xanthine, 0.005 units xanthine oxidase.
- Equilibrate to 25°C and monitor at A550nm until the value is constant using a spectrophotometer.
- Add 50 ul of recombinant SOD protein in various concentrations (0.5 ug, 1 ug) in assay buffer.
- Mix by inversion and record the increase at A550nm for 5 minutes.
-
Purity
> 95 % SDS-PAGE.
ab93946 was purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMKHSLPDLPYDYGALEPHINAQIMQLHHSK HHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWT NLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFN KERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKA IWNVINWENVTERYMACKK
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 8.00
Constituents: 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine)This product is an active protein and may elicit a biological response in vivo, handle with caution.