Recombinant Human RSV glycoprotein (His tag) (ab206016)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Endotoxin level:
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human RSV glycoprotein (His tag) -
Purity
> 90 % SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
HKVTLTTAIIQDATSQIKNTTPTYLTQDPQLGISFSNLSEITSQTTTILA STTPGVKSNLQPTTVKTKNTTTTQTQPSKPTTKQRQNKPPNKPNNDFHFE VFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTFKTTKKDHK PQTTKPKEVPTTKPTEEPTINTTKTNIITTLLTNNTTGNPKLTSQMETFH STSSEGNLSPSQVSTTSEHPSQPSSPPNTTR -
Predicted molecular weight
26 kDa including tags -
Amino acids
67 to 297 -
Tags
His tag C-Terminus
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab206016 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5% -
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- Attachment glycoprotein
- Attachment glycoprotein G
- Major surface glycoprotein G
see all -
Relevance
This protein of 86 kDa is the major surface glycoprotein G of Human respiratory syncytial virus. Glycoprotein G is the attachment protein of respiratory syncytial virus. RSV is a 100-350 nm enveloped virus belonging to the Paramyxoviridae, genus, Pneumovirus, that causes minor respiratory infections in adults and bronchitis and bronchopneumonia in children. Its genome consists of single stranded, negative sense RNA that encodes three envelope glycoproteins, a small hydrophobic (SH) protein of unknown function, a major glycoprotein (G) known as the attachment protein, and a fusion (F) protein. -
Cellular localization
Virion membrane.
Images
-
SDS-PAGE - Recombinant Human RSV glycoprotein (ab206016)
SDS-PAGE analysis of reduced ab206016 and staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 46-90 kDa in SDS-PAGE due to glycosylation.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab206016 has not yet been referenced specifically in any publications.
Preparation and Storage
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
Images
-
SDS-PAGE - Recombinant Human RSV glycoprotein (ab206016)
SDS-PAGE analysis of reduced ab206016 and staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 46-90 kDa in SDS-PAGE due to glycosylation.
