Recombinant human p23 protein (ab222791)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant human p23 protein
See all p23 proteins and peptides -
Biological activity
When ab222791 (4 μM) was added to Aha1-activated HSP90 (2 μM) in 33mM Hepes pH7.2, 30mM NaCl, 5mM MgCl2, 1mM DTT, 1.5mM ATP in a 100 μl reaction at 37°C, it eliminated all Aha1-mediated ATPase stimulation as well as intrinsic HSP90 ATPase activity. (This was an enzyme-linked ATP regeneration assay tracking loss of NADH absorbance at 340nm).
-
Purity
> 90 % SDS-PAGE.
Affinity purified. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
SHMQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFK HLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNW LSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDS QDSDDEKMPDLE -
Predicted molecular weight
19 kDa -
Amino acids
1 to 160 -
Additional sequence information
Full-length protein with the addition of SH residues at the N-terminus.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
pH: 7.20
Constituents: 10% Glycerol, 0.48% HEPES, 0.46% Sodium chlorideThis product is an active protein and may elicit a biological response in vivo, handle with caution.