Recombinant Human NUCB2 protein (ab101042)
Key features and details
- Expression system: Escherichia coli
- Tags: His tag N-Terminus
- Suitable for: WB, SDS-PAGE
-
Product name
Recombinant Human NUCB2 protein
See all NUCB2 proteins and peptides -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MKHHHHHHASVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDV LETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL -
Predicted molecular weight
11 kDa including tags -
Amino acids
25 to 106 -
Tags
His tag N-Terminus
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. Please see notes section.
Constituents: 0.242% Tris, 0.29% Sodium chloride
-
ReconstitutionAdd deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.
Images
-
SDS-PAGE - Recombinant Human NUCB2 protein (ab101042)14% SDS-PAGE analysis of ab101042
Lane 1: Molecular weight markers; 14, 21, 31, 45, 66, 97 kDa
Lane 2: ab101042 (reduced and heated, 5μg/lane)
Lane 3: ab101042 (non-reduced and non-heated, 5μg/lane)
