Recombinant Rat NUCB2 protein (ab157014)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Rat NUCB2 protein
See all NUCB2 proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Rat -
Sequence
VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREK LQKADIEEIRSGRLSQELDLVSHKVRTRLDEL -
Predicted molecular weight
8 kDa -
Amino acids
25 to 106
Specifications
Our Abpromise guarantee covers the use of ab157014 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Previously labelled as Nucleobindin 2.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Constituent: 99% PBS
-
ReconstitutionReconstitute with 100µl sterile water. Further dilutions should be made with medium containing 0.2% bovine serum albumin. 0.1mg/ml after reconstitution.
General Info
-
Alternative names
- DNA binding protein NEFA
- DNA-binding protein NEFA
- Gastric cancer antigen Zg4
see all -
Function
Calcium-binding protein. May have a role in calcium homeostasis. -
Tissue specificity
Predominantly expressed in spleen, testis and normal stomach. -
Sequence similarities
Belongs to the nucleobindin family.
Contains 2 EF-hand domains. -
Cellular localization
Membrane. Cytoplasm. Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab157014 has not yet been referenced specifically in any publications.
Preparation and Storage
- DNA binding protein NEFA
- DNA-binding protein NEFA
- Gastric cancer antigen Zg4