Recombinant human Macrophage Inflammatory Protein 1 alpha / CCL3 + MIP 1 alpha (Active) (ab256081)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant human Macrophage Inflammatory Protein 1 alpha / CCL3 + MIP 1 alpha (Active) -
Biological activity
(1) THP-1 chemotaxis (2) Human PBMC chemotaxis.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQV CADPSEEWVQKYVSDLELSA -
Predicted molecular weight
8 kDa -
Amino acids
23 to 92 -
Additional sequence information
Full-length mature chain lacking the signal peptide.
Associated products
Specifications
Our Abpromise guarantee covers the use of ab256081 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at room temperature. Store at -20°C.
Constituent: 0.1% Trifluoroacetic acid
0.2 micron filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.
General Info
-
Cellular localization
Macrophage Inflammatory Protein 1 alpha / CCL3: Secreted. MIP 1 alpha: Secreted.
Images
-
SDS-PAGE - Recombinant human Macrophage Inflammatory Protein 1 alpha / CCL3 + MIP 1 alpha (Active) (ab256081)
SDS-PAGE analysis of ab256081 (1 μg) under non-reducing (Lane 1) and reducing (Lane 2) conditions. ab256081 is a homodimer with a predicted MW of 36.4 (monomer id 18.2 kDa).
4-20% Tris-Glycine gel. Coomassie Blue staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab256081 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Cellular localization
Macrophage Inflammatory Protein 1 alpha / CCL3: Secreted. MIP 1 alpha: Secreted.
Images
-
SDS-PAGE - Recombinant human Macrophage Inflammatory Protein 1 alpha / CCL3 + MIP 1 alpha (Active) (ab256081)
SDS-PAGE analysis of ab256081 (1 μg) under non-reducing (Lane 1) and reducing (Lane 2) conditions. ab256081 is a homodimer with a predicted MW of 36.4 (monomer id 18.2 kDa).
4-20% Tris-Glycine gel. Coomassie Blue staining.