Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Recombinant Human LRP5 protein (ab114399)

Recombinant Human LRP5 protein (ab114399)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Wheat germ
  • Suitable for: SDS-PAGE, ELISA, WB

You may also be interested in

Product image
Anti-Thyroid Peroxidase ELISA Kit (ab178632)
Product image
Anti-Glutamate Receptor 1 (AMPA subtype) (phospho S845) antibody [EPR2148] (ab76321)
Haloperidol, D2 antagonist (ab120080)
9-Nitro-20(S)-camptothecin, derivative of camptothecin (ab142409)

Description

  • Product name

    Recombinant Human LRP5 protein
  • Expression system

    Wheat germ
  • Accession

    O75197
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDVSEEAIKQT YLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETN
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      41 to 130

Preparation and Storage

  • Alternative names

    • BMND1
    • EVR1
    • EVR4
    • HBM
    • Low density lipoprotein receptor related protein 5
    • Low density lipoprotein receptor related protein 7
    • Low-density lipoprotein receptor-related protein 5
    • LR3
    • LRP-5
    • Lrp5
    • LRP5_HUMAN
    • LRP7
    • OPPG
    • OPS
    • OPTA1
    • Osteoporosis pseudoglioma syndrome
    • VBCH2
    see all
  • Function

    Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes. Cell-surface coreceptor of Wnt/beta-catenin signaling, which plays a pivotal role in bone formation. The Wnt-induced Fzd/LRP6 coreceptor complex recruits DVL1 polymers to the plasma membrane which, in turn, recruits the AXIN1/GSK3B-complex to the cell surface promoting the formation of signalsomes and inhibiting AXIN1/GSK3-mediated phosphorylation and destruction of beta-catenin. Appears be required for postnatal control of vascular regression in the eye. Required for posterior patterning of the epiblast during gastrulation.
  • Tissue specificity

    Widely expressed, with the highest level of expression in the liver.
  • Involvement in disease

    Defects in LRP5 are the cause of vitreoretinopathy exudative type 4 (EVR4) [MIM:601813]. EVR4 is a disorder of the retinal vasculature characterized by an abrupt cessation of growth of peripheral capillaries, leading to an avascular peripheral retina. This may lead to compensatory retinal neovascularization, which is thought to be induced by hypoxia from the initial avascular insult. New vessels are prone to leakage and rupture causing exudates and bleeding, followed by scarring, retinal detachment and blindness. Clinical features can be highly variable, even within the same family. Patients with mild forms of the disease are asymptomatic, and their only disease related abnormality is an arc of avascular retina in the extreme temporal periphery. EVR4 inheritance can be autosomal dominant or recessive.
    Genetic variations in LRP5 are a cause of susceptibility to osteoporosis (OSTEOP) [MIM:166710]; also known as senile osteoporosis or postmenopausal osteoporosis. Osteoporosis is characterized by reduced bone mass, disruption of bone microarchitecture without alteration in the composition of bone. Osteoporotic bones are more at risk of fracture.
    Defects in LRP5 are the cause of osteoporosis-pseudoglioma syndrome (OPPG) [MIM:259770]; also known as osteogenesis imperfecta ocular form. OPPG is a recessive disorder characterized by very low bone mass and blindness. Individualy with OPPG are prone to develop bone fractures and deformations and have various eye abnormalities, including phthisis bulbi, retinal detachments, falciform folds or persistent vitreal vasculature.
    Defects in LRP5 are a cause of high bone mass trait (HBM) [MIM:601884]. HBM is a rare phenotype characterized by exceptionally dense bones. HBM individuals show otherwise a completely normal skeletal structure and no other unusual clinical findings.
    Defects in LRP5 are a cause of endosteal hyperostosis Worth type (WENHY) [MIM:144750]; also known as autosomal dominant osteosclerosis. WENHY is an autosomal dominant sclerosing bone dysplasia clinically characterized by elongation of the mandible, increased gonial angle, flattened forehead, and the presence of a slowly enlarging osseous prominence of the hard palate (torus palatinus). Serum calcium, phosphorus and alkaline phosphatase levels are normal. Radiologically, it is characterized by early thickening of the endosteum of long bones, the skull and of the mandible. With advancing age, the trabeculae of the metaphysis become thickened. WENHY becomes clinically and radiologically evident by adolescence, does not cause deformity except in the skull and mandible, and is not associated with bone pain or fracture. Affected patients have normal height, proportion, intelligence and longevity.
    Defects in LRP5 are the cause of osteopetrosis autosomal dominant type 1 (OPTA1) [MIM:607634]. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. The disorder occurs in two forms: a severe autosomal recessive form occurring in utero, infancy, or childhood, and a benign autosomal dominant form occurring in adolescence or adulthood. OPTA1 is characterized by generalized osteosclerosis most pronounced in the cranial vault. Patients are often asymptomatic, but some suffer from pain and hearing loss. It appears to be the only type of osteopetrosis not associated with an increased fracture rate.
    Defects in LRP5 are the cause of van Buchem disease type 2 (VBCH2)[MIM:607636]. VBCH2 is an autosomal dominant sclerosing bone dysplasia characterized by cranial osteosclerosis, thickened calvaria and cortices of long bones, enlarged mandible and normal serum alkaline phosphatase levels.
  • Sequence similarities

    Belongs to the LDLR family.
    Contains 4 EGF-like domains.
    Contains 3 LDL-receptor class A domains.
    Contains 20 LDL-receptor class B repeats.
  • Post-translational
    modifications

    Phosphorylation of cytoplasmic PPPSP motifs regulates the signal transduction of the Wnt signaling pathway through acting as a docking site for AXIN1.
  • Cellular localization

    Membrane. Endoplasmic reticulum. Chaperoned to the plasma membrane by MESD.
  • Target information above from: UniProt accession O75197 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human LRP5 protein (ab114399)
    SDS-PAGE - Recombinant Human LRP5 protein (ab114399)
    12.5% SDS-PAGE analysis of ab114399, stained with Coomassie Blue.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Histone H3 (di methyl K79) antibody [EPR17467] - ChIP Grade (ab177184)

  •  
  • Product image

    Anti-FBXO2 antibody [EPR7328(2)] (ab133717)

  •  
  • Product image

    Anti-DIAPH1 antibody [EPR7948] - BSA and Azide free (ab248325)

  •  
  • Product image

    Anti-NDUFB4 antibody [EPR16240] - BSA and Azide free (ab251115)

  •  
  • Product image

    Anti-Tyrosyl tRNA synthetase/TyrRS antibody - N-terminal (ab226398)

  •  
  • Product image

    Anti-ARSB antibody - C-terminal (ab181410)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.