Recombinant human KGF protein (Animal Free) (ab217393)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC
-
Product name
Recombinant human KGF protein (Animal Free)
See all KGF proteins and peptides -
Biological activity
Determined by dose-dependent ability to reduce tetrazolium salt, WST-8, by dehydrogenase activities of BaF3 cells expressing FGF receptors using Cell Counting Kit-8 (CCK-8).
-
Purity
> 95 % SDS-PAGE.
Greater than 95% by SDS-PAGE gel and HPLC analyses. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDK RGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKK ECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKK EQKTAHFLPMAIT -
Predicted molecular weight
23 kDa -
Amino acids
32 to 194 -
Additional sequence information
This product is for the mature full length protein from aa 32 to 194. The signal peptide is not included.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionLyophilised from a sterile filtered solution. Centrifuge the vial prior to opening. Reconstitute in Water to a concentration of 0.1 - 1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20C to -80C
