Recombinant human IL-1RA protein (ab83761)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE
-
Product name
Recombinant human IL-1RA protein
See all IL-1RA proteins and peptides -
Biological activity
Activity: The ED50 of IL-1RA is typically 30-100 ng/ml as measured by its ability to inhibit IL-1 mediated proliferation using the murine D10S cell line.
-
Purity
> 95 % SDS-PAGE. -
Expression system
HEK 293 cells -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
Theoretical Sequence: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDV VPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDK RFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVT KFYFQEDE
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
Constituents: 1% Human serum albumin, 10% Trehalose
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Images
-
Functional Studies - Recombinant human IL-1RA protein (ab83761)Densitometry of protein isoforms visualised by 2-DE.
The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
The triangle indicates the theoretical MW and pI of the protein. -
SDS-PAGE - Recombinant human IL-1RA protein (ab83761)1D SDS-PAGE of ab83761 before and after treatment with glycosidases to remove oligosaccharides.
Lane 1: ab83761
Lane 2: ab83761 treated with PNGase F to remove potential N-linked glycans.
Lane 3: ab83761 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
10 μg protein loaded per lane. Drop in MW after treatment with PNGase F indicates the presence of N-linked glycans. Faint bands in lane 3 and lane 4 are glycosidase enzymes.
