Recombinant human IgG1 protein (Active) (ab155632)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE
-
Product name
Recombinant human IgG1 protein (Active)
See all IgG1 proteins and peptides -
Biological activity
Immobilized Human CD64, His Tag at 10μg/mL (100 μL/well) can bind recombinant Human IgG1 protein (ab155632) with a linear range of 7-41 ng/mL.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK -
Predicted molecular weight
26 kDa -
Amino acids
99 to 330
Associated products
Specifications
Our Abpromise guarantee covers the use of ab155632 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Upon reconstitution ab155632 should be aliquoted and stored at -80°C and is stable for 3 months.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.
pH: 7.4
Constituents: Tris, Glycine, L-Arginine, Sodium chloride
Normally trehalose is added as protectantThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- Ig gamma 1 chain C region
- IgG heavy chain locus
- IGHG1
see all -
Relevance
There are four IgG subclasses (IgG1, 2, 3 and 4) in humans, named in order of their abundance in serum (IgG1 being the most abundant). -
Cellular localization
Secreted. Cell membrane; Single-pass membrane protein
Images
-
SDS-PAGE - Recombinant Human IgG1 protein (ab155632)
Recombinant Human IgG1 protein on SDS-PAGE under reducing conditions. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
-
ELISA - Recombinant Human IgG1 protein (ab155632)Immobilized Human CD64, His Tag at 10μg/mL (100 μL/well) can bind Recombinant Human IgG1 protein (ab155632) with a linear range of 7-41 ng/mL.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab155632 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- Ig gamma 1 chain C region
- IgG heavy chain locus
- IGHG1
see all -
Relevance
There are four IgG subclasses (IgG1, 2, 3 and 4) in humans, named in order of their abundance in serum (IgG1 being the most abundant). -
Cellular localization
Secreted. Cell membrane; Single-pass membrane protein
Images
-
SDS-PAGE - Recombinant Human IgG1 protein (ab155632)
Recombinant Human IgG1 protein on SDS-PAGE under reducing conditions. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
-
ELISA - Recombinant Human IgG1 protein (ab155632)
Immobilized Human CD64, His Tag at 10μg/mL (100 μL/well) can bind Recombinant Human IgG1 protein (ab155632) with a linear range of 7-41 ng/mL.
