Recombinant human GDF11 protein (Active) (ab218080)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant human GDF11 protein (Active)
See all GDF11 proteins and peptides -
Biological activity
Alkaline phosphatase activity induced in ATDC-5 cells.
Acceptance Criteria: ED50 ≤100 ng/mL(≥ 1.0 x 104 units/mg).
-
Purity
> 95 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYM FMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPG MVVDRCGCS -
Predicted molecular weight
13 kDa -
Amino acids
299 to 407 -
Additional sequence information
Source: genetically modified E.coli. Mature protein without the signal peptide and propeptide Exists as a dimer. Predicted MW: Dimer, 12.5/24.9 kDa (with 109/218 amino acids)
-
Preparation and Storage
-
Alternative names
- BMP 11
- BMP-11
- BMP11
see all -
Function
Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. Play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern. -
Sequence similarities
Belongs to the TGF-beta family. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Functional analysis of ab218080
-
SDS-PAGE analysis of ab218080 at 1 μg under (1) non-reducing and (2) reducing conditions in a 4-20% Tris-Glycine gel, stained with Coomassie Blue. Human GDF11 is a homodimer with a total; predicted MW of 24.9 kDa (each monomer 12.4 kDa).