Recombinant human Flt3 ligand/Flt3L protein (Active) (ab214614)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant human Flt3 ligand/Flt3L protein (Active)
See all Flt3 ligand/Flt3L proteins and peptides -
Biological activity
The ED50 was determined by the dose-dependent stimulation of the proliferation of human AML5 cells is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1 x 106 units/mg.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRL VLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTN ISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEA TAPTAPQP -
Predicted molecular weight
25 kDa including tags -
Amino acids
27 to 184 -
Tags
His tag C-Terminus
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab214614 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Previously labelled as Flt3 ligand.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.
Constituent: 99% PBS
Lyophilized from 0.2 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100 µL sterile water to a concentration of 0.1mg/mL. PBS containing at least 0.1% BSA should be used for further dilutions. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- FL
- Flt 3 ligand
- Flt 3L
see all -
Function
Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab214614 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.
Constituent: 99% PBS
Lyophilized from 0.2 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100 µL sterile water to a concentration of 0.1mg/mL. PBS containing at least 0.1% BSA should be used for further dilutions. Working aliquots are stable for up to 3 months when stored at -20°C.
