Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Other

Recombinant human Flt3 ligand/Flt3L protein (Active) (ab214614)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Endotoxin level:
  • Active: Yes
  • Tags: His tag C-Terminus
  • Suitable for: Functional Studies, SDS-PAGE

You may also be interested in

Product image
Recombinant Human CLN3 protein (ab132559)
Product image
Anti-DDX19A antibody (ab108462)
Anti-Ferritin antibody (ab86249)
Product image
AKT1 + AKT2 + AKT3 (pS473) ELISA Kit (ab126432)

Description

  • Product name

    Recombinant human Flt3 ligand/Flt3L protein (Active)
    See all Flt3 ligand/Flt3L proteins and peptides
  • Biological activity

    The ED50 was determined by the dose-dependent stimulation of the proliferation of human AML5 cells is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1 x 106 units/mg.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

  • Expression system

    HEK 293 cells
  • Accession

    P49771
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRL VLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTN ISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEA TAPTAPQP
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      27 to 184
    • Tags

      His tag C-Terminus
  • Associated products

    • Related Products

      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-6X His tag® antibody (ab9108)

    Specifications

    Our Abpromise guarantee covers the use of ab214614 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Functional Studies

      SDS-PAGE

    • Form

      Lyophilized
    • Additional notes

      Previously labelled as Flt3 ligand.

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.

      Constituent: 99% PBS

      Lyophilized from 0.2 µm filtered solution.

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      Reconstitute with 100 µL sterile water to a concentration of 0.1mg/mL. PBS containing at least 0.1% BSA should be used for further dilutions. Working aliquots are stable for up to 3 months when stored at -20°C.

    General Info

    • Alternative names

      • FL
      • Flt 3 ligand
      • Flt 3L
      • Flt3 L
      • FLT3 LG
      • Flt3 ligand
      • Flt3L
      • FLT3L_HUMAN
      • Flt3lg
      • Fms related tyrosine kinase 3 ligand
      • Fms-related tyrosine kinase 3 ligand
      • SL cytokine
      see all
    • Function

      Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
    • Cellular localization

      Secreted and Cell membrane.
    • Target information above from: UniProt accession P49771 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab214614? Please let us know so that we can cite the reference in this datasheet.

    ab214614 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.

      Constituent: 99% PBS

      Lyophilized from 0.2 µm filtered solution.

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      Reconstitute with 100 µL sterile water to a concentration of 0.1mg/mL. PBS containing at least 0.1% BSA should be used for further dilutions. Working aliquots are stable for up to 3 months when stored at -20°C.

    Images

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Alternative products to Recombinant human Flt3 ligand/Flt3L protein (Active) (ab214614)

    •  
    • Recombinant Mouse Flt3 ligand/Flt3L protein (ab51985)

      Applications: FuncS, SDS-PAGE

    •  
    • Recombinant rhesus monkey Flt3 ligand/Flt3L protein (ab200249)

      Applications: FuncS, HPLC, SDS-PAGE

    •  
    • Product image

      Recombinant human Flt3 ligand/Flt3L protein (Animal Free) (ab179623)

      Applications: FuncS, HPLC, SDS-PAGE

    •  
    • Product image

      Recombinant pig Flt3 ligand/Flt3L protein (ab233680)

      Applications: FuncS, SDS-PAGE

    •  
    • Product image

      Recombinant human Flt3 ligand/Flt3L protein (ab237554)

      Applications: FuncS, HPLC, SDS-PAGE

    •  
    • Product image

      Recombinant pig Flt3 ligand/Flt3L protein (Active) (ab233607)

      Applications: FuncS, SDS-PAGE

    •  
    • Product image

      Recombinant mouse Flt3 ligand/Flt3L protein (ab129139)

      Applications: FuncS, SDS-PAGE

    •  
    • Product image

      Recombinant human Flt3 ligand/Flt3L protein (ab168707)

      Applications: FuncS, SDS-PAGE

    •  
    • Recombinant human Flt3 ligand/Flt3L protein (ab9690)

      Applications: FuncS, SDS-PAGE

    Clear all

    Recently viewed products

    •  
    • Product image

      Anti-Nuclear Pore Complex Proteins antibody [Mab414] (ab24609)

    •  
    • Product image

      Anti-Aurora A (phospho S342) antibody (ab111410)

    •  
    • Product image

      Anti-C16orf96 antibody (ab243433)

    •  
    • Product image

      Anti-HDHD1A antibody (ab254989)

    •  
    • Product image

      Human TNFAIP3 knockout HeLa cell pellet (ab278935)

    •  
    • Product image

      Phospho-CDK1 (T161) ELISA Kit (ab279756)

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.