Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cardiovascular Blood Coagulation Intrinsic

Recombinant Human Factor XII protein (ab158410)

Recombinant Human Factor XII protein (ab158410)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Wheat germ
  • Tags: GST tag N-Terminus
  • Suitable for: ELISA, WB

You may also be interested in

Product image
Human Apo-H Antibody Pair - BSA and Azide free (Apolipoprotein H) (ab253425)
Recombinant mouse Factor X protein (ab92703)
Product image
Anti-Apo-H antibody (ab227252)
Product image
Mouse FX ELISA kit (total FX antigen) (ab272779)

Description

  • Product name

    Recombinant Human Factor XII protein
    See all Factor XII proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCGQRLRK SLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQ DRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALL RLQEDADGSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEY ASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGG PLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS
    • Amino acids

      1 to 300
    • Tags

      GST tag N-Terminus

Preparation and Storage

  • Alternative names

    • Factor XII
    • Beta factor XIIa part 1
    • Beta factor XIIa part 2
    • Coagulation factor XII
    • Coagulation factor XIIa heavy chain
    • Coagulation factor XIIa light chain
    • F12
    • F12 deficiency
    • FA12_HUMAN
    • Factor XII deficiency
    • HAE3
    • HAEX
    • HAF
    • HAF deficiency
    • Hageman factor
    see all
  • Function

    Factor XII is a serum glycoprotein that participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. Prekallikrein is cleaved by factor XII to form kallikrein, which then cleaves factor XII first to alpha-factor XIIa and then trypsin cleaves it to beta-factor XIIa. Alpha-factor XIIa activates factor XI to factor XIa.
  • Involvement in disease

    Defects in F12 are the cause of factor XII deficiency (FA12D) [MIM:234000]; also known as Hageman factor deficiency. This trait is an asymptomatic anomaly of in vitro blood coagulation. Its diagnosis is based on finding a low plasma activity of the factor in coagulating assays. It is usually only accidentally discovered through pre-operative blood tests. F12 deficiency is divided into two categories, a cross-reacting material (CRM)-negative group (negative F12 antigen detection) and a CRM-positive group (positive F12 antigen detection).
    Defects in F12 are the cause of hereditary angioedema type 3 (HAE3) [MIM:610618]; also known as estrogen-related HAE or hereditary angioneurotic edema with normal C1 inhibitor concentration and function. HAE is characterized by episodic local subcutaneous edema, and submucosal edema involving the upper respiratory and gastrointestinal tracts. HAE3 occurs exclusively in women and is precipitated or worsened by high estrogen levels (e.g., during pregnancy or treatment with oral contraceptives). It differs from HAE types 1 and 2 in that both concentration and function of C1 inhibitor are normal.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 2 EGF-like domains.
    Contains 1 fibronectin type-I domain.
    Contains 1 fibronectin type-II domain.
    Contains 1 kringle domain.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    Factor XII is activated by kallikrein in alpha-factor XIIa, which is then further converted by trypsin into beta-factor XIIa. Alpha-factor XIIa is composed of the NH2-terminal heavy chain (Coagulation factor XIIa heavy chain) and the COOH-terminal light chain (Coagulation factor XIIa light chain), connected by a disulfide bond. Beta-factor XIIa is composed of 2 chains linked by a disulfide bond, a light chain (Beta-factor XIIa part 2), corresponding to the COOH-terminal light chain (Coagulation factor XIIa light chain) and a nonapeptide (Beta-factor XIIa part 1).
    O- and N-glycosylated. The O-linked polysaccharides were not identified, but are probably the mucin type linked to GalNAc.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession P00748 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human Factor XII protein (ab158410)
    SDS-PAGE - Recombinant Human Factor XII protein (ab158410)
    ab158410 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant Human Factor XII protein (ab158410)

  •  
  • Native Human Factor XIIa protein (Biotin) (ab229848)

    Applications: SDS-PAGE

  •  
  • Product image

    Recombinant Mouse Factor XII protein (ab170085)

    Applications: SDS-PAGE

  •  
  • Native Human Factor XII protein (ab62423)

    Applications: FuncS, SDS-PAGE

Clear all

Recently viewed products

  •  
  • Product image

    Anti-RNA polymerase II CTD repeat YSPTSPS (phospho S5) antibody [EP1510Y] (ab76292)

  •  
  • Product image

    Anti-GABA A Receptor alpha 2/GABRA2 antibody [N399/19] (ab193311)

  •  
  • Product image

    Anti-Macrophage Inflammatory Protein 1 alpha / CCL3 antibody [EPR16618-90] - BSA and Azide free (ab229699)

  •  
  • Product image

    Anti-68kDa Neurofilament/NF-L antibody [NfL23] - BSA and Azide free (ab273480)

  •  
  • Product image

    Anti-TIM 3 antibody [CAL69] - BSA and Azide free (ab252214)

  •  
  • Product image

    Recombinant human CTLA4 protein (Active) (ab167727)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.