Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Recombinant human ErbB2 / HER2 (mutated G776V + G776C) protein (Cytoplasmic domain) (ab191466)

Recombinant human ErbB2 / HER2 (mutated G776V + G776C) protein (Cytoplasmic domain) (ab191466)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Baculovirus infected Sf9 cells
  • Purity: > 75% SDS-PAGE
  • Active: Yes
  • Tags: proprietary tag N-Terminus
  • Suitable for: Functional Studies, SDS-PAGE

You may also be interested in

Product image
Recombinant Human VEGF Receptor 3 protein (ab54260)
Product image
Anti-GRP94 antibody [EPR22847-50] - BSA and Azide free (ab256312)
Product image
Human ST2 Antibody Pair - BSA and Azide free (IL1RL1) (ab256737)
Product image
Phagocytosis Assay Kit (Zymosan Substrate) (ab211156)

Description

  • Product name

    Recombinant human ErbB2 / HER2 (mutated G776V + G776C) protein (Cytoplasmic domain)
    See all ErbB2 / HER2 proteins and peptides
  • Biological activity

    Specific activity: 5 nmol/min/mg.

  • Purity

    > 75 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

    P04626
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELRKVKV LGSGAFGTVY KGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYV MAGVGSPYVSRLLGICLTSTVQ LVTQLMPYGCLLDHVRENRGRLGSQD LLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKS PNHVKITDFGLARL LDIDETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWEL MT FGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRP RFRELVSE FSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMG DLVDAEEYLVPQQGFFCPDP APGAGGMVHHRHRSSSTRSGGGDLTLGL EPSEEEAPRSPLAPSEGAGSDVFDGDLGMGAA KGLQSLPTHDPSPLQR YSEDPTVPLPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREG PLPA ARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHP PPAFSP AFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
    • Predicted molecular weight

      115 kDa including tags
    • Amino acids

      676 to 1255
    • Modifications

      mutated G776V + G776C
    • Tags

      proprietary tag N-Terminus
    • Additional sequence information

      Cytoplasmic domain.

Preparation and Storage

  • Alternative names

    • Verb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog
    • C erb B2/neu protein
    • CD340
    • CD340 antigen
    • Cerb B2/neu protein
    • CerbB2
    • Erb b2 receptor tyrosine kinase 2
    • ErbB-2 proto-oncogene
    • ERBB2
    • ERBB2_HUMAN
    • HER 2
    • HER 2/NEU
    • HER2
    • Herstatin
    • Human epidermal growth factor receptor 2
    • Metastatic lymph node gene 19 protein
    • MLN 19
    • MLN19
    • NEU
    • NEU proto oncogene
    • Neuro/glioblastoma derived oncogene homolog
    • Neuroblastoma/glioblastoma derived oncogene homolog
    • NGL
    • p185erbB2
    • Proto-oncogene c-ErbB-2
    • Proto-oncogene Neu
    • Receptor tyrosine-protein kinase erbB-2
    • TKR1
    • Tyrosine kinase type cell surface receptor HER2
    • Tyrosine kinase-type cell surface receptor HER2
    • V erb b2 avian erythroblastic leukemia viral oncogene homolog 2
    • V erb b2 avian erythroblastic leukemia viral oncogene homolog 2 (neuro/glioblastoma derived oncogene homolog)
    • V erb b2 avian erythroblastic leukemia viral oncoprotein 2
    • V erb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog
    • V erb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
    • Verb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
    see all
  • Function

    Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane. In turn, membrane-bound APC allows the localization of MACF1 to the cell membrane, which is required for microtubule capture and stabilization.
    In the nucleus is involved in transcriptional regulation. Associates with the 5'-TCAAATTC-3' sequence in the PTGS2/COX-2 promoter and activates its transcription. Implicated in transcriptional activation of CDKN1A; the function involves STAT3 and SRC. Involved in the transcription of rRNA genes by RNA Pol I and enhances protein synthesis and cell growth.
  • Tissue specificity

    Expressed in a variety of tumor tissues including primary breast tumors and tumors from small bowel, esophagus, kidney and mouth.
  • Involvement in disease

    Hereditary diffuse gastric cancer
    Glioma
    Ovarian cancer
    Lung cancer
    Gastric cancer
    Chromosomal aberrations involving ERBB2 may be a cause gastric cancer. Deletions within 17q12 region producing fusion transcripts with CDK12, leading to CDK12-ERBB2 fusion leading to truncated CDK12 protein not in-frame with ERBB2.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated. Autophosphorylation occurs in trans, i.e. one subunit of the dimeric receptor phosphorylates tyrosine residues on the other subunit (Probable). Ligand-binding increases phosphorylation on tyrosine residues (PubMed:27134172). Signaling via SEMA4C promotes phosphorylation at Tyr-1248 (PubMed:17554007). Dephosphorylated by PTPN12 (PubMed:27134172).
  • Cellular localization

    Cytoplasm. Nucleus and Cell membrane. Cytoplasm, perinuclear region. Nucleus. Translocation to the nucleus requires endocytosis, probably endosomal sorting and is mediated by importin beta-1/KPNB1.
  • Target information above from: UniProt accession P04626 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant human ErbB2 / HER2 (mutated G776V + G776C) protein (Cytoplasmic domain) (ab191466)
    Functional Studies - Recombinant human ErbB2 / HER2 (mutated G776V + G776C) protein (Cytoplasmic domain) (ab191466)

    The specific activity of ErbB2 / HER2 (ab191466) was determined to be 175 nmol/min/mg as per activity assay protocol and was equivalent to 6 nmol/min/mg as per radiometric assay

  • SDS-PAGE - Recombinant human ErbB2 / HER2 (mutated G776V + G776C) protein (Cytoplasmic domain) (ab191466)
    SDS-PAGE - Recombinant human ErbB2 / HER2 (mutated G776V + G776C) protein (Cytoplasmic domain) (ab191466)
    SDS PAGE analysis of ab191466
  • SDS-PAGE - Recombinant human ErbB2 / HER2 (mutated G776V + G776C) protein (Cytoplasmic domain) (ab191466)
    SDS-PAGE - Recombinant human ErbB2 / HER2 (mutated G776V + G776C) protein (Cytoplasmic domain) (ab191466)
    SDS PAGE analysis of ab191466
  • SDS-PAGE - Recombinant human ErbB2 / HER2 (mutated G776V + G776C) protein (Cytoplasmic domain) (ab191466)
    SDS-PAGE - Recombinant human ErbB2 / HER2 (mutated G776V + G776C) protein (Cytoplasmic domain) (ab191466)

    SDS-PAGE of ErbB 2 (mutated G776 VC). Approx MW 115 kDa.

  • Functional Studies - Recombinant human ErbB2 / HER2 (mutated G776V + G776C) protein (Cytoplasmic domain) (ab191466)
    Functional Studies - Recombinant human ErbB2 / HER2 (mutated G776V + G776C) protein (Cytoplasmic domain) (ab191466)

    Specific Activity: Sample Kinase Activity Plot. ErbB 2 (mutated G776 VC) activity assay with or without substrate Poly (Glu:Tyr, 4:1) peptide. The specific activity of ErbB2 / HER2 (mutated G776 VC) was determined to be 5 nmol /min/mg.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant human ErbB2 / HER2 (mutated G776V + G776C) protein (Cytoplasmic domain) (ab191466)

  •  
  • Product image

    Recombinant Human ErbB2 / HER2 protein (His tag) (ab215657)

    Applications: SDS-PAGE

  •  
  • Product image

    Recombinant human ErbB2 / HER2 protein (Active) (ab60866)

    Applications: FuncS, SDS-PAGE

  •  
  • Product image

    Recombinant human ErbB2 / HER2 protein (ab190418)

    Applications: FuncS, SDS-PAGE

  •  
  • Product image

    Recombinant Mouse ErbB2 / HER2 protein (His tag) (ab168691)

    Applications: SDS-PAGE

Clear all

Recently viewed products

  •  
  • Product image

    Rab Family (RAB4, RAB5, RAB7, RAB8A, RAB9, RAB10) Antibody Sampler Panel (ab263466)

  •  
  • Product image

    Alexa Fluor® 488 Anti-HLA Class II DRB1 antibody [EPR6148] (ab207376)

  •  
  • Product image

    Recombinant Mouse Galectin 3 protein (ab137144)

  •  
  • Product image

    Human RCHY1 (Pirh2) knockout HeLa cell line (ab265478)

  •  
  • Product image

    Recombinant human coronavirus SARS-CoV-2 3CL protease protein (Active) (ab277614)

  •  
  • Product image

    Recombinant Mouse PD-L1 protein (ab130039)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.