Recombinant Human EPO protein (ab155618)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 97% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human EPO protein
See all EPO proteins and peptides -
Purity
> 97 % SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA WKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVS GLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLR GKLKLYTGEACRTGDR -
Predicted molecular weight
18 kDa -
Amino acids
28 to 193
Associated products
Specifications
Our Abpromise guarantee covers the use of ab155618 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 95% PBS, 5% Trehalose -
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- EP
- EPO
- EPO alpha
see all -
Relevance
Human erythropoietin is member of the EPO/TPO family and encodes a secreted, glycosylated cytokine hormone composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. It is produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals. -
Cellular localization
Secreted
Images
-
SDS-PAGE - Recombinant Human EPO protein (ab155618)
SDS-PAGE analysis of reduced ab155618 stained overnight with Coomassie Blue. The protein has a calculated MW of 18.4 kDa. The protein migrates as 28-35 kDa under reducing (Lane 1) condition due to glycosylation.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab155618 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- EP
- EPO
- EPO alpha
see all -
Relevance
Human erythropoietin is member of the EPO/TPO family and encodes a secreted, glycosylated cytokine hormone composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. It is produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals. -
Cellular localization
Secreted
Images
-
SDS-PAGE - Recombinant Human EPO protein (ab155618)
SDS-PAGE analysis of reduced ab155618 stained overnight with Coomassie Blue. The protein has a calculated MW of 18.4 kDa. The protein migrates as 28-35 kDa under reducing (Lane 1) condition due to glycosylation.
