Recombinant Human Ephrin A4 protein (Fc Chimera) (ab219713)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human Ephrin A4 protein (Fc Chimera)
See all Ephrin A4 proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFAL YMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFL PGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG -
Predicted molecular weight
43 kDa including tags -
Amino acids
26 to 171 -
Additional sequence information
This protein carries a human IgG1 Fc tag at the C terminus. This product is for the mature full length protein. The signal peptide and propeptide are not included. (Accession # AAI07484).
Specifications
Our Abpromise guarantee covers the use of ab219713 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.61% Tris buffer, 0.75% Glycine, L-Arginine, Sodium chloride
Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%. -
ReconstitutionReconstitute with sterile deionized water to a concentration of 100 µg/ml.
General Info
-
Alternative names
- EFL 4
- EFL4
- EFN A4
see all -
Function
May play a role in the interaction between activated B lymphocytes and dendritic cells in tonsils. -
Tissue specificity
Expressed in the adult spleen, lymph node, prostate, ovary, small intestine, and colon, and in fetal heart, lung, liver and kidney. Also detected in hematopoietic cell lines. -
Sequence similarities
Belongs to the ephrin family. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab219713 has not yet been referenced specifically in any publications.
Preparation and Storage
- EFL 4
- EFL4
- EFN A4