Recombinant Human Eotaxin 2 protein (Fc Chimera) (ab216211)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human Eotaxin 2 protein (Fc Chimera)
See all Eotaxin 2 proteins and peptides -
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGD PKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC -
Predicted molecular weight
10 kDa -
Amino acids
27 to 119 -
Additional sequence information
This product is the mature full length protein from aa 27 to 119. The signal peptide is not included. Fused to the N-terminus of the Fc region of human IgG1 (AAH69391.1).
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab216211 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 100% PBS
Lyophilised from 0.2µm filtered solution. -
ReconstitutionReconstitute 10µg vial in 100µl sterile water. Add 1X PBS to the desired protein concentration. Stable for at least 1 year after receipt when stored at -20°C. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- C C motif chemokine 24
- C-C motif chemokine 24
- CCL24
see all -
Function
Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3. -
Tissue specificity
Activated monocytes and activated T lymphocytes. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsN-glycosylated. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab216211 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 100% PBS
Lyophilised from 0.2µm filtered solution. -
ReconstitutionReconstitute 10µg vial in 100µl sterile water. Add 1X PBS to the desired protein concentration. Stable for at least 1 year after receipt when stored at -20°C. Working aliquots are stable for up to 3 months when stored at -20°C.