Recombinant Human DcR1 protein (ab151632)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant Human DcR1 protein -
Purity
> 95 % SDS-PAGE.
ab151632 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDY TNASNNEPSC FPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGE VQVSNCTSWD DIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAE ETMTTSPGTP APAAEETMTTSPGTPAVDHHHHHH -
Predicted molecular weight
22 kDa including tags -
Amino acids
26 to 221 -
Tags
His tag C-Terminus
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab151632 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
pH: 7.2
Constituents: 64% Sodium chloride, 3% Sodium phosphate monobasic, monohydrate, 28% disodium;hydrogen phosphate;dodecahydrate -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
General Info
-
Alternative names
- Antagonist decoy receptor for TRAIL/Apo 2L
- CD263
- Cytotoxic TRAIL receptor 3
see all -
Relevance
DcR1 / TRAIL-R3 / TRID / LIT is one of the two putative decoy receptors identified for TRAIL, one of the members of TNF family of apoptosis inducing proteins. The other putative decoy receptor is called DcR2 / TRUNDD / TRAIL-R4. DcR1 is attached to the cell surface through glycophospholipid anchor. It has the extracellular TRAIL binding domain but lacks the cytoplasmic domain to induce apoptotic signal. Hence overexpression of DcR1 inhibits the TRAIL induced apoptosis. -
Cellular localization
Cell Membrane and Cytoplasmic
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab151632 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
pH: 7.2
Constituents: 64% Sodium chloride, 3% Sodium phosphate monobasic, monohydrate, 28% disodium;hydrogen phosphate;dodecahydrate -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.