Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Innate Immunity Chemokines Alpha Chemokine Rec. (CXCR)

Recombinant Human CXCR4 protein (ab159899)

Recombinant Human CXCR4 protein (ab159899)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Wheat germ
  • Tags: GST tag N-Terminus
  • Suitable for: ELISA, WB

You may also be interested in

Product image
Anti-cxcr4b antibody - N-terminal (ab229623)
Product image
Alexa Fluor® 594 Anti-CXCR4 antibody [EPUMBR3] (ab216735)
Product image
Alexa Fluor® 555 Anti-CXCR4 antibody [UMB2] (ab211982)
Product image
Anti-CXCR3 antibody - N-terminal (ab154033)

Description

  • Product name

    Recombinant Human CXCR4 protein
    See all CXCR4 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
    • Amino acids

      1 to 46
    • Tags

      GST tag N-Terminus

Preparation and Storage

  • Alternative names

    • C-X-C chemokine receptor type 4
    • CD184
    • CD184 antigen
    • Chemokine (C X C motif) receptor 4
    • Chemokine CXC Motif Receptor 4
    • CXC-R4
    • CXCR-4
    • CXCR4
    • CXCR4_HUMAN
    • D2S201E
    • FB22
    • Fusin
    • HM89
    • HSY3RR
    • LAP 3
    • LAP3
    • LCR1
    • LESTR
    • Leukocyte derived seven transmembrane domain receptor
    • Leukocyte-derived seven transmembrane domain receptor
    • Lipopolysaccharide associated protein 3
    • Neuropeptide Y receptor Y3
    • NPY3R
    • NPYR
    • NPYRL
    • NPYY3
    • NPYY3R
    • Probable G protein coupled receptor lcr1 homolog
    • SDF 1 receptor
    • SDF-1 receptor
    • SEVEN-TRANSMEMBRANE-SEGMENT RECEPTOR
    • Stromal cell derived factor 1 receptor
    • Stromal cell-derived factor 1 receptor
    • WHIM
    • WHIMS
    see all
  • Function

    Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ions levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhance intracellular calcium ions and reduce cellular cAMP levels. Involved in haematopoiesis and in cardiac ventricular septum formation. Plays also an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Could be involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival. Acts as a coreceptor (CD4 being the primary receptor) for HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env-mediated fusion of the virus.
  • Tissue specificity

    Expressed in numerous tissues, such as peripheral blood leukocytes, spleen, thymus, spinal cord, heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, cerebellum, cerebral cortex and medulla (in microglia as well as in astrocytes), brain microvascular, coronary artery and umbilical cord endothelial cells. Isoform 1 is predominant in all tissues tested.
  • Involvement in disease

    Defects in CXCR4 are a cause of WHIM syndrome (WHIM) [MIM:193670]; also known as warts, hypogammaglobulinemia, infections and myelokathexis. WHIM syndrome is an immunodeficiency disease characterized by neutropenia, hypogammaglobulinemia and extensive human papillomavirus (HPV) infection. Despite the peripheral neutropenia, bone marrow aspirates from affected individuals contain abundant mature myeloid cells, a condition termed myelokathexis.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Domain

    The amino-terminus is critical for ligand binding. Residues in all four extracellular regions contribute to HIV-1 coreceptor activity.
  • Post-translational
    modifications

    Phosphorylated on agonist stimulation. Rapidly phosphorylated on serine and threonine residues in the C-terminal. Phosphorylation at Ser-324 and Ser-325 leads to recruitment of ITCH, ubiquitination and protein degradation.
    Ubiquitinated by ITCH at the cell membrane on agonist stimulation. The ubiquitin-dependent mechanism, endosomal sorting complex required for transport (ESCRT), then targets CXCR4 for lysosomal degradation. This process is dependent also on prior Ser-/Thr-phosphorylation in the C-terminal of CXCR4. Also binding of ARRB1 to STAM negatively regulates CXCR4 sorting to lysosomes though modulating ubiquitination of SFR5S.
    Sulfation on Tyr-21 is required for efficient binding of CXCL12/SDF-1alpha and promotes its dimerization.
    O- and N-glycosylated. Asn-11 is the principal site of N-glycosylation. There appears to be very little or no glycosylation on Asn-176. N-glycosylation masks coreceptor function in both X4 and R5 laboratory-adapted and primary HIV-1 strains through inhibiting interaction with their Env glycoproteins. The O-glycosylation chondroitin sulfate attachment does not affect interaction with CXCL12/SDF-1alpha nor its coreceptor activity.
  • Cellular localization

    Cell membrane. In unstimulated cells, diffuse pattern on plasma membrane. On agonist stimulation, colocalizes with ITCH at the plasma membrane where it becomes ubiquitinated.
  • Target information above from: UniProt accession P61073 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human CXCR4 protein (ab159899)
    SDS-PAGE - Recombinant Human CXCR4 protein (ab159899)
    ab159899 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant Human CXCR4 protein (ab159899)

  •  
  • CXCR4 peptide (ab8126)

    Applications: BL

  •  
  • CXCR4 peptide (ab155072)

    Applications: BL

  •  
  • Product image

    Recombinant Human CXCR4 protein (ab155716)

    Applications: SDS-PAGE

Clear all

Recently viewed products

  •  
  • Product image

    Recombinant Mouse VISTA protein (ab208315)

  •  
  • Recombinant Human FOXO4/AFX protein (ab252398)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.