Recombinant human CTGF protein (ab50044)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant human CTGF protein
See all CTGF proteins and peptides -
Biological activity
Biological Activity : Determined by the dose-dependent stimulation of the proliferation of HUVEC cells. The expected ED50 for this effect is 1.0-2.0 µg/ml.
-
Purity
> 95 % SDS-PAGE.
Endotoxin level is less than 0.1 ng per µg (1EU/µg). -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLP VEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA -
Predicted molecular weight
11 kDa -
Amino acids
253 to 349
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.
