Recombinant Human Coronin 1a/TACO protein (ab161325)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
-
Product name
Recombinant Human Coronin 1a/TACO protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRG LDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQ AK -
Amino acids
360 to 461 -
Tags
GST tag N-Terminus
-
Preparation and Storage
-
Alternative names
- Actin binding protein
- CLABP
- Clipin A
see all -
Function
May be a crucial component of the cytoskeleton of highly motile cells, functioning both in the invagination of large pieces of plasma membrane, as well as in forming protrusions of the plasma membrane involved in cell locomotion. In mycobacteria-infected cells, its retention on the phagosomal membrane prevents fusion between phagosomes and lysosomes. -
Tissue specificity
Expressed in brain, thymus, spleen, bone marrow and lymph node. Low in lung and gut. -
Sequence similarities
Belongs to the WD repeat coronin family.
Contains 7 WD repeats. -
Cellular localization
Cytoplasm > cytoskeleton. Cytoplasm > cell cortex. Cytoplasmic vesicle > phagosome membrane. In non-infected macrophages, associated with the cortical microtubule network. In mycobacteria-infected macrophages, becomes progressively relocalized and retained around the mycobacterial phagosomes. Retention on the phagosomal membrane is strictly dependent on mycobacterial viability and not due to impaired acidification. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human Coronin 1a/TACO protein (ab161325)ab161325 on a 12.5% SDS-PAGE stained with Coomassie Blue.