Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (ab272105)
Key features and details
- Expression system: HEK 293 cells
- Tags: Fc tag C-Terminus
- Suitable for: Indirect ELISA, SDS-PAGE
-
Product name
Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera)
See all SARS-CoV-2 Spike Glycoprotein S1 proteins and peptides -
Expression system
HEK 293 cells -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human coronavirus -
Sequence
(Without the proprietary tag) MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS TQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI IRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNK SWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGY FKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLT PGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASV YAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF VIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN YLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPT NGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTG VLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCL IGAEHVNNSYECDIPIGAGICASY -
Amino acids
1 to 674 -
Tags
Fc tag C-Terminus -
Additional sequence information
Sheep Fc-Tag (predominantly monomeric). Sequence Strain: Wuhan-Hu-1. Accession: NCBI: YP_009724390.1
-
Images
-
Indirect ELISA showing primary antibody ab273073 (CR3022, human chimeric) binding to the antigens ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)) and ab273068 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Active)). Plates were coated with 100ng/well ab272105 or ab273068 and binding of ab273073 assessed in serial dilution from 200ng/ml primary antibody in duplicate. Binding was detected using ab98624, an anti-human Fc secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.
-
Indirect ELISA showing primary antibody ab277513 (CV30) binding to the antigen ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)). Plates were coated with 100ng/well ab272105 and binding of ab277513 assessed in serial dilution from 100ng/ml primary antibody in duplicate. Binding was detected using ab98624, an anti-human Fc secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.
-
Indirect ELISA showing primary antibody ab277512 (CV1) binding to the antigen ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)). Plates were coated with 100ng/well ab272105 and binding of ab277512 assessed in serial dilution from 100ng/ml primary antibody in duplicate. Binding was detected using ab98624, an anti-human Fc secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.
-
Indirect competition ELISA showing competitive binding of primary antibody ab277513 (CV30) to the antigen ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)) in the presence of 2nM His-tagged human ACE2. Plates were coated with 100ng/well ab272105 and binding of the recombinant ACE2 determined in duplicate in the presence of a serial dilution (from 330nM) of primary antibody. His-tagged ACE2 binding was detected using ab1187, an anti-His tag secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.
-
Indirect competition ELISA showing competitive binding of primary antibody ab277512 (CV1) to antigen ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)) in the presence of 2nM His-tagged human ACE2. Plates were coated with 100ng/well ab272105 and binding of the recombinant ACE2 determined in duplicate in the presence of a serial dilution (from 330nM) of primary antibody. His-tagged ACE2 binding was detected using ab1187, an anti-His tag secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.
-
SDS-PAGE analysis of ab272105.