Recombinant Human CDKN2A/p16INK4a protein (Tagged) (ab216254)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: HPLC, SDS-PAGE
-
Product name
Recombinant Human CDKN2A/p16INK4a protein (Tagged)
See all CDKN2A/p16INK4a proteins and peptides -
Purity
> 95 % SDS-PAGE.
>95% by HPLC analysis. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
EPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQV MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAG ARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGP SDIPDGYGRKKRRQRRR -
Predicted molecular weight
18 kDa including tags -
Amino acids
2 to 156 -
Additional sequence information
12-residue C-terminal TAT peptide (GYGRKKRRQRRR) tag.
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab216254 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C. Avoid freeze / thaw cycle.
Constituents: PBS, 0.02% DTT
-
ReconstitutionCentrifuge the vial prior to opening. Reconstitute in PBS, pH 8.0 to a concentration of 0.1-1.0 mg/m. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. The lyophilized protein is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C.
General Info
-
Alternative names
- CCM2
- CDK4 inhibitor p16 INK4
- CDK4I
see all -
Cellular localization
Cytoplasmic and Nuclear
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab216254 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C. Avoid freeze / thaw cycle.
Constituents: PBS, 0.02% DTT
-
ReconstitutionCentrifuge the vial prior to opening. Reconstitute in PBS, pH 8.0 to a concentration of 0.1-1.0 mg/m. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. The lyophilized protein is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C.
