Recombinant Human CDKN2A protein (ab216197)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: HPLC, SDS-PAGE
-
Product name
Recombinant Human CDKN2A protein -
Purity
> 95 % SDS-PAGE.
>95% by HPLC analysis. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQ VMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRA GARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEG PSDIPD -
Predicted molecular weight
17 kDa -
Amino acids
1 to 156
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab216197 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Add 1% BSA for extra stability. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
Constituents: 0.15% Sodium citrate, 0.58% Sodium chloride, 0.01% DTT
-
ReconstitutionCentrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/m. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. Lyophilized protein is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C.
General Info
-
Alternative names
- Alternative reading frame
- ARF
- CDK4 inhibitor p16 INK4
see all -
Relevance
Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein. Heterodimer with CDK4 or CDK6. Predominant p16 complexes contained CDK6. Interacts (isoforms 1,2 and 4) with CDK4 (both 'T-172'-phosphorylated and non-phosphorylated forms); the interaction inhibits cyclin D-CDK4 kinase activity. Interacts with ISCO2. Widely expressed but not detected in brain or skeletal muscle. Isoform 3 is pancreas-specific. -
Cellular localization
Cytoplasmic and Nuclear
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab216197 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Add 1% BSA for extra stability. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
Constituents: 0.15% Sodium citrate, 0.58% Sodium chloride, 0.01% DTT
-
ReconstitutionCentrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/m. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. Lyophilized protein is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C.