Recombinant human CD38 protein (Active) (APC) (ab269982)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant human CD38 protein (Active) (APC)
See all CD38 proteins and peptides -
Biological activity
Assay conditions: Add CD38 enzyme to 50 μl reaction mix containing NGD+ (Nicotinamide Guanine Dinucleotide). Incubate 4 min at room temperature. Read fluorescence (λ exc=300 nm, λ em=410 nm).
-
Purity
> 90 % SDS-PAGE. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
VPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGA FISKHPCNITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDM FTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTV SRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWV IHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPE DSSCTSEI -
Predicted molecular weight
31 kDa including tags -
Amino acids
43 to 300 -
Tags
His tag C-Terminus -
Additional sequence information
Labeled with APC. NM_001775
-
-
Conjugation
APC. Ex: 645nm, Em: 660nm
Preparation and Storage
-
Alternative names
- Acute lymphoblastic leukemia cells antigen CD38
- ADP ribosyl cyclase
- ADP ribosyl cyclase 1
see all -
Function
Synthesizes cyclic ADP-ribose, a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system. -
Tissue specificity
Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma. -
Sequence similarities
Belongs to the ADP-ribosyl cyclase family. -
Developmental stage
Preferentially expressed at both early and late stages of the B and T-cell maturation. It is also detected on erythroid and myeloid progenitors in bone marrow, where the level of surface expression was shown to decrease during differentiation of blast-forming unit E to colony-forming unit E. -
Cellular localization
Membrane. - Information by UniProt
Images
-
Functional analysis of ab269982.
Add CD38 enzyme to 50 μl reaction mix containing NGD+ (Nicotinamide Guanine Dinucleotide). Incubate 4 min at room temperature. Read fluorescence (λ exc=300 nm, λ em=410 nm).
-
SDS-PAGE analysis of ab269982 ona 4-20% gel with Coomassie staining.
Lane 1: ab269982 (8 μg).
Lane 2: Unlabeled CD38 (4 μg).
Lane 3: APC (4 μg).