Recombinant human CD272/BTLA protein (Active) (ab214139)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant human CD272/BTLA protein (Active)
See all CD272/BTLA proteins and peptides -
Biological activity
Measured in a competitive binding assay.
-
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCV KLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTT LYVTDVKSASERPSKDEMASRPWLLYR -
Predicted molecular weight
33 kDa -
Amino acids
31 to 157 -
Additional sequence information
The extracellular domain is fused to the N erminus of the Fc region of Human IgG1. NP_861445.3
Specifications
Our Abpromise guarantee covers the use of ab214139 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product was previously labelled as CD272
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 99% PBS
Lyophilized from 0.2µm-filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100 µl sterile water. Add 1X PBS to the desired protein concentration.
General Info
-
Alternative names
- B and T lymphocyte associated protein
- B and T lymphocyte attenuator
- B and T lymphocyte associated
see all -
Function
Lymphocyte inhibitory receptor which inhibits lymphocytes during immune response. -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Post-translational
modificationsPhosphorylated on Tyr residues by TNFRSF14 and by antigen receptors cross-linking, both inducing association with PTPN6 and PTPN11.
N-glycosylated. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab214139 has not yet been referenced specifically in any publications.
Preparation and Storage
- B and T lymphocyte associated protein
- B and T lymphocyte attenuator
- B and T lymphocyte associated