Recombinant Human BST2/Tetherin protein (ab114390)
Key features and details
- Expression system: Wheat germ
- Suitable for: WB, SDS-PAGE, ELISA
-
Product name
Recombinant Human BST2/Tetherin protein
See all BST2/Tetherin proteins and peptides -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
PLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAA TCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRR ENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ -
Predicted molecular weight
41 kDa including tags -
Amino acids
40 to 180
-
Preparation and Storage
-
Alternative names
- Bone marrow stromal antigen 2
- Bone marrow stromal cell antigen
- Bone marrow stromal cell antigen 2
see all -
Function
May be involved in the sorting of secreted proteins (By similarity). May be involved in pre-B-cell growth. Antiretroviral defense protein, that blocks release of retrovirus from the cell surface. Depleted unpon HIV-1 infection by viral VPU protein through 20S proteasome degradation. Depleted upon infection by human Kaposi's sarcoma-associated herpesvirus (KSHV) through ubiquitination and subsequent degradation. May play a role in B-cell activation in rheumatoid arthritis. -
Tissue specificity
Predominantly expressed in liver, lung, heart and placenta. Lower levels in pancreas, kidney, skeletal muscle and brain. Overexpressed in multiple myeloma cells. Highly expressed during B-cell development, from pro-B precursors to plasma cells. Highly expressed on T-cells, monocytes, NK cells and dendritic cells (at protein level). -
Sequence similarities
Belongs to the tetherin family. -
Domain
The extracellular coiled coil domain is important for virus retention at the cell surface and prevention of virus spreading. -
Post-translational
modificationsMonoubiquitinated by KSHV E3 ubiquitin-protein ligase K5, leading to its targeting to late endosomes and degradation. -
Cellular localization
Golgi apparatus > trans-Golgi network. Cell membrane. Cell membrane. Late endosome. Targeted to late endosomes upon KSHV infection and subsequent ubiquitination. Targeted to the trans-Golgi network by viral VPU protein. - Information by UniProt