Recombinant human BAFF-R protein (Fc Chimera) (ab83931)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE
-
Product name
Recombinant human BAFF-R protein (Fc Chimera)
See all BAFF-R proteins and peptides -
Biological activity
The ED50 of BAFF Receptor – Fc Chimera is typically 0.02-0.08 μg/ml as measured by its ability to neutralize BAFF-mediated proliferation of the RPMI 8226 cell line.
-
Purity
> 95 % SDS-PAGE. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
Theoretical Sequence: SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTA LQPQESVGAGAGEAALPGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQP ENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK -
Additional sequence information
A fusion of the signal peptide of human GH receptor to the extracellular domain of human BAFF-R (aa 2-73), and the Fc region of human IgG1 (aa 93-330), expressed in modified human 293 cells.
-
Preparation and Storage
-
Alternative names
- B cell activating factor receptor
- B-cell-activating factor receptor
- BAFF R
see all -
Function
B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response. -
Tissue specificity
Highly expressed in spleen and lymph node, and in resting B-cells. Detected at lower levels in activated B-cells, resting CD4+ T-cells, in thymus and peripheral blood leukocytes. -
Involvement in disease
Defects in TNFRSF13C are the cause of immunodeficiency common variable type 4 (CVID4) [MIM:613494]; also called antibody deficiency due to BAFFR defect. CVID4 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low. -
Sequence similarities
Contains 1 TNFR-Cys repeat. -
Cellular localization
Membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant human BAFF-R protein (Fc Chimera) (ab83931)Lane 1 – MW markers; Lane 2 – ab83931; Lane 3 – ab83931 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83931 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. 3 μg of protein was loaded per lane. Gels were stained with Coomassie G250.
Drop in MW after treatment with PNGase F indicates the presence of N-linked glycans. A subsequent drop in MW after treatment with a glycosidase cocktail indicates O-linked glycans are also present. Additional high MW bands in lane 4 are glycosidase enzymes. -
SDS-PAGE - Recombinant human BAFF-R protein (Fc Chimera) (ab83931)A sample of ab83931 without carrier protein was reduced and alkylated. 40 μg of protein was loaded, focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Spot train (Deep Purple™ stained) indicates presence of multiple glycoforms of BAFF Receptor - Fc Chimera. Spots within the spot train were cut from the gel and identified by protein mass fingerprinting as BAFF Receptor - Fc Chimera. -
Functional Studies - Recombinant human BAFF-R protein (Fc Chimera) (ab83931)Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates the purified human cell expressed protein exists in multiple glycoforms, which differ according to their level of post-translational modification.
