Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Growth Factors/Hormones TNF

Recombinant human BAFF-R protein (Fc Chimera) (ab83931)

Recombinant human BAFF-R protein (Fc Chimera) (ab83931)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Active: Yes
  • Suitable for: SDS-PAGE

You may also be interested in

Product image
Anti-BAFF-R antibody [EPR23590-68] - BSA and Azide free (ab273572)
Product image
Anti-LRR-1 antibody (ab169947)
Product image
Anti-LRR-1 antibody (ab221772)
Product image
Anti-BCMA antibody - C-terminal (ab199264)

Description

  • Product name

    Recombinant human BAFF-R protein (Fc Chimera)
    See all BAFF-R proteins and peptides
  • Biological activity

    The ED50 of BAFF Receptor – Fc Chimera is typically 0.02-0.08 μg/ml as measured by its ability to neutralize BAFF-mediated proliferation of the RPMI 8226 cell line.

  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

    Q96RJ3
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      Theoretical Sequence: SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTA LQPQESVGAGAGEAALPGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQP ENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK
    • Additional sequence information

      A fusion of the signal peptide of human GH receptor to the extracellular domain of human BAFF-R (aa 2-73), and the Fc region of human IgG1 (aa 93-330), expressed in modified human 293 cells.

Preparation and Storage

  • Alternative names

    • B cell activating factor receptor
    • B-cell-activating factor receptor
    • BAFF R
    • BAFF receptor
    • BAFF-R
    • BAFFR
    • BLyS receptor 3
    • BlySR3
    • BR 3
    • BR3
    • BROMIX
    • CD 268
    • CD268
    • CD268 antigen
    • CVID4
    • MGC138235
    • OTTHUMP00000028746
    • Prolixin
    • TNFRSF 13C
    • Tnfrsf13c
    • TR13C_HUMAN
    • Tumor necrosis factor receptor subunit member 13C
    • Tumor necrosis factor receptor superfamily member 13C
    see all
  • Function

    B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response.
  • Tissue specificity

    Highly expressed in spleen and lymph node, and in resting B-cells. Detected at lower levels in activated B-cells, resting CD4+ T-cells, in thymus and peripheral blood leukocytes.
  • Involvement in disease

    Defects in TNFRSF13C are the cause of immunodeficiency common variable type 4 (CVID4) [MIM:613494]; also called antibody deficiency due to BAFFR defect. CVID4 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low.
  • Sequence similarities

    Contains 1 TNFR-Cys repeat.
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession Q96RJ3 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant human BAFF-R protein (Fc Chimera) (ab83931)
    SDS-PAGE - Recombinant human BAFF-R protein (Fc Chimera) (ab83931)
    Lane 1 – MW markers; Lane 2 – ab83931; Lane 3 – ab83931 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83931 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. 3 μg of protein was loaded per lane. Gels were stained with Coomassie G250.
    Drop in MW after treatment with PNGase F indicates the presence of N-linked glycans. A subsequent drop in MW after treatment with a glycosidase cocktail indicates O-linked glycans are also present. Additional high MW bands in lane 4 are glycosidase enzymes.
  • SDS-PAGE - Recombinant human BAFF-R protein (Fc Chimera) (ab83931)
    SDS-PAGE - Recombinant human BAFF-R protein (Fc Chimera) (ab83931)
    A sample of ab83931 without carrier protein was reduced and alkylated. 40 μg of protein was loaded, focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Spot train (Deep Purple™ stained) indicates presence of multiple glycoforms of BAFF Receptor - Fc Chimera. Spots within the spot train were cut from the gel and identified by protein mass fingerprinting as BAFF Receptor - Fc Chimera.
  • Functional Studies - Recombinant human BAFF-R protein (Fc Chimera) (ab83931)
    Functional Studies - Recombinant human BAFF-R protein (Fc Chimera) (ab83931)
    Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates the purified human cell expressed protein exists in multiple glycoforms, which differ according to their level of post-translational modification.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant human BAFF-R protein (Fc Chimera) (ab83931)

  •  
  • Recombinant human BAFF-R protein (ab200303)

    Applications: FuncS, SDS-PAGE

  •  
  • Product image

    Recombinant mouse BAFF-R protein (Active) (ab219672)

    Applications: ELISA, HPLC, SDS-PAGE

  •  
  • Product image

    Recombinant mouse BAFF-R protein (Fc Chimera) (ab157042)

    Applications: Flow Cyt, FuncS, SDS-PAGE

  •  
  • Product image

    Recombinant human BAFF-R protein (ab157066)

    Applications: FuncS, SDS-PAGE

  •  
  • Recombinant human BAFF-R protein (ab50233)

    Applications: Inhibition, SDS-PAGE

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Kv1.2 antibody [K14/16] (ab192758)

  •  
  • Product image

    Anti-Secretin receptor/SCTR antibody (ab234830)

  •  
  • Anti-Thyroid Peroxidase/TPO antibody [MoAb47] (ab12500)

  •  
  • Rabbit F(ab')2 Anti-Dog IgG H&L (Alkaline Phosphatase) (ab136764)

  •  
  • Product image

    Recombinant Human Cytokeratin 17 protein (ab116974)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.