Recombinant Human B7-H6 protein (Fc Chimera) (ab215479)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human B7-H6 protein (Fc Chimera)
See all B7-H6 proteins and peptides -
Biological activity
Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated human T cells.
-
Purity
> 98 % SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDK EVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEV VVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAIN ITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGT VYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS -
Predicted molecular weight
80 kDa including tags -
Amino acids
25 to 262 -
Additional sequence information
Fused to the N-terminus of the Fc region of mouse IgG2a. NCBI Accession No. NP_001189368.1.
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab215479 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C. Avoid freeze / thaw cycle.
Constituent: 100% PBS
0.2 µm-filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100 µL sterile water. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- B7 homolog 6
- B7-H6
- B7H6
see all -
Function
Triggers NCR3-dependent natural killer cell activation. -
Tissue specificity
Not detected in any normal tissue tested. Expressed at the surface of several tumor cell lines including T and B lymphomas, myeloid leukemias, melanomas, carcinomas and large T SV40 antigen-transformed cells (at protein level). -
Sequence similarities
Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Domain
The C-terminal part is similar to retroviral Gag protein. This putative protein seems to be the result of a fusion between an Ig-like domain-containing protein and a ERV. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab215479 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C. Avoid freeze / thaw cycle.
Constituent: 100% PBS
0.2 µm-filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100 µL sterile water. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.