Recombinant Hirudin protein (ab73660)
Key features and details
- Expression system: Pichia pastoris
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant Hirudin protein
See all Hirudin proteins and peptides -
Biological activity
The specific activity was found to be >14,000ATU/mg.
-
Purity
> 95 % SDS-PAGE.
ab73660 is purified by proprietary chromatographic techniques. Purity is greater than 95.0% as determined by RP-HPLC and SDS-PAGE. -
Expression system
Pichia pastoris -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Leech -
Sequence
VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQS HNDGDFEEIPEEYLQ -
Amino acids
1 to 65 -
Additional sequence information
Identical to natural Hirudin except for the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.00
Constituents: PBS, 2% MannitolThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Upon reconstitution ab73660 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.