Recombinant Hepatitis C Virus NS3 + NS4A (mutated D168V) protein (ab198098)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Active: Yes
- Tags: His-DDDDK tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant Hepatitis C Virus NS3 + NS4A (mutated D168V) protein
See all Hepatitis C Virus NS3 + NS4A proteins and peptides -
Biological activity
Specific Activity: 45 pmole/min/µg.
Assay Conditions: Assay was performed in 100 µl HCV assay buffer containing 50 mM Tris, pH7.4, 150 mM NaCl, 5 mM DTT, 10% glycerol, and 5 µM fluorescently labeled HCV substrate peptide. Reaction was continuously monitored at room temperature for 20 min. at ex350/em500.
-
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Sequence
MDYKDDDDKHHHHHHGSVVIVGRIILSGSGSITAYSQQTRGVLGCIITSL TGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPI TQMYTNVDLDLVGWQAPPGARSMTPCSCGSSDLYLVTRHADVIPVRRRGD SRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGVFRAAVCTRGVAKAVVFIP VESMETTMRS -
Predicted molecular weight
22 kDa including tags -
Modifications
mutated D168V -
Tags
His-DDDDK tag N-Terminus -
Additional sequence information
Fusion protein of aa21-32 of NS4A, linker (4 aa) and aa3-181 of NS3 with Asp-to-Val mutation on aa168.
-
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.63% Tris HCl, 2.32% Sodium chloride, 0.2% Triton X-100, 0.08% Beta mercaptoethanol, 30% Glycerol (glycerin, glycerine)
Contains 100 µg/ml DDDDK peptide.This product is an active protein and may elicit a biological response in vivo, handle with caution.
Images
-
Functional Studies - Recombinant Hepatitis C Virus NS3 + NS4A (mutated D168V) protein (ab198098)
Activity assay using ab198098.
-
SDS-PAGE - Recombinant Hepatitis C Virus NS3 + NS4A (mutated D168V) protein (ab198098)4-20% SDS-PAGE analysis of 2 µg ab198098 with Coomassie staining.
