Recombinant EN-TEV Protease (mutated S219N) protein (Tagged-His Tag) (ab134877)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Tags: His tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant EN-TEV Protease (mutated S219N) protein (Tagged-His Tag)
See all EN-TEV Protease proteins and peptides -
Biological activity
Complete digestion of 50µg of T7 Tag-HBxAg protein using 1µg TEV enzyme (in 1/50 ratio) in either 3 hours at 37 °C or 12 hours at 4 °C.The "standard" reaction buffer for TEV protease is 50 mM Tris-HCl (pH 8.0), 0.5 mM EDTA and 1mM DTT. The duration of the cleavage reaction is typically overnight, although lots of cleavage will happen in the first few hours and prolonged incubation times may not lead to proportional increases in cleavage. TEV protease is maximally active at 34 °C, but we recommend performing the digest at room temperature (20 °C) or 4 °C. TEV protease is only three-fold less active at 4 °C than at 20 °C.
Typically, a good rule of thumb for initial test of digestion is 1 µg TEV enzyme per 50 - 100µg target protein ratio. Perform a small-scale reaction first, if possible, to gauge the efficiency of processing. -
Purity
> 98 % SDS-PAGE.
ab134877 is sterile-filtered. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Tobacco etch virus -
Sequence
GHHHHHHHGESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFII TNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFP PFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKH WIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTN QEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNRRRRR -
Amino acids
2037 to 2073 -
Tags
His tag N-Terminus
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.02% DTT, 0.79% Tris HCl, 0.015% EDTAThis product is an active protein and may elicit a biological response in vivo, handle with caution.
Images
-
Functional Studies - Recombinant EN-TEV Protease (mutated S219N) protein (Tagged-His Tag) (ab134877)4-12% SDS-PAGE gel.
M: Protein Marker
Lane 1: N‐terminal tag HBxAg‐11R protein before TEV enzyme digestion.
Lane 2: N‐terminal tag HBxAg‐11R protein digested using 1/50 dilution (1µg TEV/ 50µg target protein at 4°C for overnight reaction) in buffer 20 mM Tris‐HCl, pH 8.0, 100 mM KCl.