Recombinant Dog Minor allergen Can f 2 protein (Tagged) (ab225653)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: MS, SDS-PAGE
-
Product name
Recombinant Dog Minor allergen Can f 2 protein (Tagged) -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Dog -
Sequence
QEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDG NLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSY LILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVV LSDDDRCQGSRD -
Predicted molecular weight
34 kDa including tags -
Amino acids
19 to 180 -
Tags
His tag N-Terminus -
Additional sequence information
This product is the mature full length protein from aa 19 to 180 with a 6xHis-SUMO tag at the N-terminus. The signal peptide is not included.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: 50% Glycerol (glycerin, glycerine), Tris buffer
Images
-
SDS-PAGE - Recombinant Dog Minor allergen Can f 2 protein (Tagged) (ab225653)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225653 with 5% enrichment gel and 15% separation gel.
-
Mass Spectrometry - Recombinant Dog Minor allergen Can f 2 protein (Tagged) (ab225653)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab225653 could indicate that this peptide derived from E.coli-expressed Canis familiaris (Dog) (Canis lupus familiaris) Minor allergen Can f 2.
-
Mass Spectrometry - Recombinant Dog Minor allergen Can f 2 protein (Tagged) (ab225653)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab225653 could indicate that this peptide derived from E.coli-expressed Canis familiaris (Dog) (Canis lupus familiaris) Minor allergen Can f 2.