Recombinant Cynomolgus monkey IL-4 protein (His tag) (ab241268)
Key features and details
- Expression system: Yeast
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: MS, SDS-PAGE
-
Product name
Recombinant Cynomolgus monkey IL-4 protein (His tag)
See all IL-4 proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Yeast -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Cynomolgus monkey -
Sequence
HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAAT VLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCP VKEANQSTLENFLERLKTIMREKYSKCSS -
Predicted molecular weight
17 kDa including tags -
Amino acids
25 to 153 -
Tags
His tag N-Terminus -
Additional sequence information
This product is the mature full length protein from aa 25 to 153. The signal peptide is not included.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
Images
-
SDS-PAGE - Recombinant Cynomolgus monkey IL-4 protein (His tag) (ab241268)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab241268 (left) or treated with EndoH digestion eznyme (right).
-
Mass Spectrometry - Recombinant Cynomolgus monkey IL-4 protein (His tag) (ab241268)Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab241268 could indicate that this peptide derived from Yeast-expressed Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) IL4.
-
Mass Spectrometry - Recombinant Cynomolgus monkey IL-4 protein (His tag) (ab241268)Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab241268 could indicate that this peptide derived from Yeast-expressed Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) IL4.
