Pterinotoxin-1, voltage-gated Na+ channel blocker (ab146044)
Key features and details
- Novel blocker of voltage-gated Na+ channels NaV1.3, NaV1.7, and NaV1.8
- CAS Number:
- Purity: > 98%
- Soluble in ammonium acetate to 20 mM or in aqueous buffer above pH8
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Pterinotoxin-1, voltage-gated Na+ channel blocker -
Description
Novel blocker of voltage-gated Na+ channels NaV1.3, NaV1.7, and NaV1.8 -
Alternative names
- Beta-theraphotoxin-Pm1a
- Beta-TRTX-Pm1a
- Beta-TRTX-Pm1a
- Peptide A
-
Biological description
Inhibits voltage-gated rat NaV1.3, NaV1.7 and NaV1.8 Na+ channels. Isolated from the Pterinochilus murinus (Usambara) spider venom.
-
Purity
> 98% -
Chemical structure
Properties
-
Molecular weight
3970.00 -
Sequence
DDCLGMFSSCDPDNDKCCEGRKCNRKDKWCKYVL (Modifications: C-terminal amide; Disulfide bonds: 3-18, 10-23, 17-30) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in ammonium acetate to 20 mM or in aqueous buffer above pH8 -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic